Protein Info for MMJJ_RS06270 in Methanococcus maripaludis JJ

Annotation: dethiobiotin synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00347: dethiobiotin synthase
  • amino acids 4 to 146 (143 residues), 157.2 bits, E=2e-50
• PF13500: AAA_26
  • amino acids 6 to 181 (176 residues), 144.3 bits, E=2.2e-46

Best Hits

Swiss-Prot: 65% identical to BIOD_METVS: ATP-dependent dethiobiotin synthetase BioD (bioD) from Methanococcus vannielii (strain ATCC 35089 / DSM 1224 / JCM 13029 / OCM 148 / SB)

KEGG orthology group: K01935, dethiobiotin synthetase [EC: 6.3.3.3] (inferred from 92% identity to mmp:MMP1573)

Predicted SEED Role

"Dethiobiotin synthetase (EC 6.3.3.3)" in subsystem Biotin biosynthesis (EC 6.3.3.3)

MetaCyc Pathways

• biotin biosynthesis from 8-amino-7-oxononanoate I (4/4 steps found)
• biotin biosynthesis II (5/6 steps found)
• biotin biosynthesis from 8-amino-7-oxononanoate II (3/4 steps found)
• biotin biosynthesis from 8-amino-7-oxononanoate III (3/5 steps found)
• biotin biosynthesis I (5/15 steps found)

KEGG Metabolic Maps

• Biotin metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.3.3

Protein Sequence (190 amino acids)

>MMJJ_RS06270 dethiobiotin synthase (Methanococcus maripaludis JJ)
MGKILKGRGVNVGYIKPIESGGVEDTTYAKTELELSEDLAVLNPINLKNPLSPNIAAAVE
DVEIDIDKIKESFQKLKESHEYLIVEGAGGVCVPIKSDYLMADLIKDLNLPCVLVSRPDL
GTINHTILSVEYLRNKGILVKGVIINCIDELKDIPYYEETFNAIEEFGHVEIIGVVKNKD
DYSINIDKLL