Protein Info for MMJJ_RS06260 in Methanococcus maripaludis JJ

Annotation: 6-carboxyhexanoate--CoA ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 244 PF03744: BioW" amino acids 2 to 243 (242 residues), 270.3 bits, see alignment E=7.6e-85

Best Hits

Swiss-Prot: 95% identical to BIOW_METMP: 6-carboxyhexanoate--CoA ligase (bioW) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K01906, 6-carboxyhexanoate--CoA ligase [EC: 6.2.1.14] (inferred from 95% identity to mmp:MMP1575)

Predicted SEED Role

"Pimeloyl-CoA synthase (EC 6.2.1.14)" in subsystem Biotin biosynthesis (EC 6.2.1.14)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.2.1.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (244 amino acids)

>MMJJ_RS06260 6-carboxyhexanoate--CoA ligase (Methanococcus maripaludis JJ)
MFSLKMRASSNGNHVSGAERLVNEEKIEEISSELIKRAMNHENGVPDFINLKVEKVTEKI
NYIEHLKIKTVNSNSKEKSREFARDILKKELEKYFLKNEKDTEKIDELIDSAFKIIDAGN
MRGAAILDLDGNRLEKSSDRGIRVRNIDTAEELSKKILKDDSLTERTVDAIAIATKVVNC
DIIAELCTSDNFSYTTGYVATKEGYFRILNLKDSGQVGGRVFFAENSDIDELYDKLENMP
VIVY