Protein Info for MMJJ_RS06255 in Methanococcus maripaludis JJ

Annotation: tRNA uridine(34) 5-carboxymethylaminomethyl modification radical SAM/GNAT enzyme Elp3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 540 PF23613: ELP3_N" amino acids 6 to 80 (75 residues), 55.9 bits, see alignment E=7e-19 TIGR01211: radical SAM enzyme/protein acetyltransferase, ELP3 family" amino acids 29 to 538 (510 residues), 773.9 bits, see alignment E=3.5e-237 PF04055: Radical_SAM" amino acids 96 to 295 (200 residues), 66.7 bits, see alignment E=5.9e-22 PF16199: Radical_SAM_C" amino acids 304 to 384 (81 residues), 72.9 bits, see alignment E=3.9e-24 PF00583: Acetyltransf_1" amino acids 425 to 528 (104 residues), 22.6 bits, see alignment E=2.2e-08

Best Hits

Swiss-Prot: 69% identical to Y1136_METJA: Uncharacterized protein MJ1136 (MJ1136) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K07739, elongator complex protein 3 [EC: 2.3.1.48] (inferred from 98% identity to mmp:MMP1577)

Predicted SEED Role

"histone acetyltransferase, ELP3 family"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.48

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (540 amino acids)

>MMJJ_RS06255 tRNA uridine(34) 5-carboxymethylaminomethyl modification radical SAM/GNAT enzyme Elp3 (Methanococcus maripaludis JJ)
MSDYSEFIRCIISNLLVEKEKIKDLDPKRKKQKVEDIKARCLRKFDLNVGFPPNSDIISQ
ASEEEKKELLPLLRKKPIRTLSGVAVVAVMTSPEPCPHGKCSFCPGGKESNFGDVPQSYT
GKEPATMRGVMYNFDPYVQTSERLSQLEKVGHPTDKVELIIMGGTFPARDIEYQENFIKR
CLDAMNGEVSETLQKAQEKNETAKHRCVALTVETRPDYCNEKEINEMLKLGTTRVELGIQ
STNDEVLEFVKRGHGTDASIKATQLLKDSGLKVSYHLIPGLPKTTPEMDKETIKTVFENP
NFKPDLIKFYPCLVIPGTEVYELWQSGEFNPMTDETAVEVITYGKSIMPKWVRTSRIQRD
IPVTVIDAGVKKSNLGELVYNNLEEEGIKCKCIRCREVGHVTYKKGIKPDLESIKLCRED
YEASGGKEIFLSFEDTKNDLLIGYLRLRIPNNPFRKEITDKSALIRQVHVCGQQKELEGS
SKELSWQHKGYGRLLIDEAEKIAREFNKDQILINSGIGVREYYKKLGYKRVGPYMGKILK