Protein Info for MMJJ_RS06235 in Methanococcus maripaludis JJ

Annotation: IGHMBP2 family helicase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 633 TIGR00376: putative DNA helicase" amino acids 17 to 630 (614 residues), 711 bits, see alignment E=7.2e-218 PF13604: AAA_30" amino acids 172 to 235 (64 residues), 29.5 bits, see alignment E=1.9e-10 PF13086: AAA_11" amino acids 172 to 421 (250 residues), 203 bits, see alignment E=2.3e-63 PF13245: AAA_19" amino acids 176 to 417 (242 residues), 33.1 bits, see alignment E=1.8e-11 PF13087: AAA_12" amino acids 426 to 613 (188 residues), 188.8 bits, see alignment E=2.4e-59

Best Hits

Swiss-Prot: 58% identical to Y104_METJA: Uncharacterized ATP-dependent helicase MJ0104 (MJ0104) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: None (inferred from 97% identity to mmp:MMP1581)

Predicted SEED Role

"Uncharacterized ATP-dependent helicase MJ0104"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (633 amino acids)

>MMJJ_RS06235 IGHMBP2 family helicase (Methanococcus maripaludis JJ)
MTLKQIYVNKFKELVKKERDHEINFHKEEIKKLGIKRENVGRAILNLNGKVLREFFGEYI
VRYGRSEKFKKTDISVGDIVLISKGNPLQSDLLGTVIEIGSNHVDVSTEIVPKWALNDIR
LDLYVNDVTFKRMLNALDKFNSTDNRLIDIILSVDSPQKSKSTEIRFLDYRLNEYQKEAV
LEALSARDLYLIHGPPGTGKTSTISEVILQEALRKNKVIATADSNIAVDNILSNISKHES
FKIVRIGHPSRISKKLMKYSLQNKITEHPNYSTLVKLKTELQKNYDLRKNFQRPDPKWRR
GMSNDDIIIFSKLNKDIRGIPKETIKQMADWVICSENIAKTKENVQKFEKKLIDDIISTS
DVVVATNSMAGSEILEDYKFDVCVIDEGSQSTEPSSLIPIVRSRKLIIAGDHKQLPPTVL
SDELELKKTLFERMIHENPEFSKILQVQYRMNEKIMEFSNEMFYENKLIAHESVKSHNLL
EIVENVSNEDNDIINEKPLQFINVDGEEQQDSFKSSYNVEEAEKVLEIVSKLQKYEIPVS
VITPYDAQVKYISKMLNTDKIDVKSVDGFQGRENEVIVISFVRTDKMGFLKDLRRLNVAV
TRAKRKLIVVGSKNLLIKDDAYSKFLNCFNDNQ