Protein Info for MMJJ_RS06225 in Methanococcus maripaludis JJ

Annotation: adenosylmethionine decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 122 TIGR03330: S-adenosylmethionine decarboxylase proenzyme" amino acids 3 to 113 (111 residues), 154.5 bits, see alignment E=6.1e-50 PF02675: AdoMet_dc" amino acids 7 to 113 (107 residues), 139.6 bits, see alignment E=2.3e-45

Best Hits

Swiss-Prot: 99% identical to SPEH_METMP: S-adenosylmethionine decarboxylase proenzyme (speH) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K01611, S-adenosylmethionine decarboxylase [EC: 4.1.1.50] (inferred from 99% identity to mmp:MMP1583)

Predicted SEED Role

"S-adenosylmethionine decarboxylase proenzyme (EC 4.1.1.50), prokaryotic class 1B" in subsystem Polyamine Metabolism (EC 4.1.1.50)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.50

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (122 amino acids)

>MMJJ_RS06225 adenosylmethionine decarboxylase (Methanococcus maripaludis JJ)
MKQLGKHIILELWGCESQALDDQPGIEKMLVNAVKACGATLICVKTHKFSPQGVTGVAVL
SESHISIHTWPELGYAAMDVFTCGEHVKPEDTIPEIEKFLKPEKTEVMDIKRGIINDGEV
KE