Protein Info for MMJJ_RS06215 in Methanococcus maripaludis JJ

Annotation: agmatinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01230: agmatinase
  • amino acids 8 to 278 (271 residues), 343.7 bits, E=4.6e-107
• PF00491: Arginase
  • amino acids 19 to 277 (259 residues), 273.5 bits, E=1.1e-85

Best Hits

Swiss-Prot: 60% identical to Y309_METJA: Uncharacterized protein MJ0309 (MJ0309) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K01480, agmatinase [EC: 3.5.3.11] (inferred from 99% identity to mmp:MMP1585)

Predicted SEED Role

"Agmatinase (EC 3.5.3.11)" in subsystem Arginine and Ornithine Degradation or Polyamine Metabolism (EC 3.5.3.11)

MetaCyc Pathways

• superpathway of arginine and polyamine biosynthesis (13/17 steps found)
• L-arginine degradation III (arginine decarboxylase/agmatinase pathway) (2/2 steps found)
• putrescine biosynthesis I (2/2 steps found)
• superpathway of putrescine biosynthesis (2/4 steps found)
• superpathway of polyamine biosynthesis I (4/8 steps found)
• superpathway of L-arginine, putrescine, and 4-aminobutanoate degradation (2/11 steps found)
• superpathway of L-arginine and L-ornithine degradation (3/13 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.3.11

Protein Sequence (282 amino acids)

>MMJJ_RS06215 agmatinase (Methanococcus maripaludis JJ)
MYFEDYSKFLTAYDTFNDADFVIFGIPFDATTSYKPGARFGPDEVRNASWGLETFSPILK
KDLIDVKICDKYNLLMEGNQSEIINRAYGASKDILEAKKIPVMIGGEHSVTYPVVKAVKS
VYDDFAVIHFDAHCDLREEYMGNEQSHASVIRRTYDLTEDIFQFGIRSGDQDEWEFGWKN
TNISMEMPTKDDIKKIKELEKPVYVTIDIDVLDPAFVPGTGTPEPCGFTPKELINSLYLL
EEIKEKIVGFDVVEVSPHYDIGKITSVTAAKIIRELILTISK