Protein Info for MMJJ_RS06195 in Methanococcus maripaludis JJ

Annotation: glutamine-hydrolyzing carbamoyl-phosphate synthase small subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01368: carbamoyl-phosphate synthase, small subunit
  • amino acids 4 to 356 (353 residues), 446 bits, E=4.8e-138
• PF00988: CPSase_sm_chain
  • amino acids 5 to 120 (116 residues), 154.2 bits, E=2.2e-49
• PF00117: GATase
  • amino acids 174 to 355 (182 residues), 169.1 bits, E=1.4e-53

Best Hits

Swiss-Prot: 97% identical to CARA_METMP: Carbamoyl-phosphate synthase small chain (carA) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K01956, carbamoyl-phosphate synthase small subunit [EC: 6.3.5.5] (inferred from 97% identity to mmp:MMP1589)

Predicted SEED Role

"Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)" in subsystem De Novo Pyrimidine Synthesis or Macromolecular synthesis operon (EC 6.3.5.5)

MetaCyc Pathways

• L-arginine biosynthesis II (acetyl cycle) (10/10 steps found)
• L-arginine biosynthesis I (via L-ornithine) (9/9 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (15/18 steps found)
• superpathway of histidine, purine, and pyrimidine biosynthesis (35/46 steps found)
• UMP biosynthesis II (6/6 steps found)
• L-arginine biosynthesis III (via N-acetyl-L-citrulline) (8/9 steps found)
• superpathway of pyrimidine ribonucleotides de novo biosynthesis (8/9 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (4/4 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (4/4 steps found)
• L-citrulline degradation (3/3 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• superpathway of arginine and polyamine biosynthesis (13/17 steps found)
• UMP biosynthesis I (5/6 steps found)
• UMP biosynthesis III (5/6 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• L-glutamine degradation I (1/1 steps found)
• L-arginine degradation V (arginine deiminase pathway) (3/4 steps found)
• L-citrulline biosynthesis (4/8 steps found)
• L-glutamate and L-glutamine biosynthesis (3/7 steps found)
• L-arginine biosynthesis IV (archaea) (4/9 steps found)
• superpathway of L-citrulline metabolism (6/12 steps found)
• allantoin degradation IV (anaerobic) (2/9 steps found)
• guadinomine B biosynthesis (2/13 steps found)

KEGG Metabolic Maps

• Glutamate metabolism
• Pyrimidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 6.3.5.5

Use Curated BLAST to search for 6.3.5.5

Protein Sequence (366 amino acids)

>MMJJ_RS06195 glutamine-hydrolyzing carbamoyl-phosphate synthase small subunit (Methanococcus maripaludis JJ)
MYGILVLEDGTIIRGEGFGAESEVLGELVFNTSMTGYVEILTDPSYKGQIITMTYPLEGN
YGVEKEWFESDGIKAEGFVVKDITGKELDEFLKEYNIPGISGVDTRYITRKIRSKGVIRS
LLKTSTNPISKDEETELIKKVVDYPDISEIDLVPEVSTKETVEYSAEDEKTRCVLIDCGV
KQSIVDCLVERGCSVVKVPYNSKEEEIISYNPDFVLVSNGPGDPENMTETVDTVKNLIGT
LPVTGICLGHQIITIALGGKTYKLKFGHRGGNQPVKDVESGKVYITSQNHGFATDDKIVP
AGSELMHMNLNDDTVEGIRKIESSDLKNTVWSVQYHPEAGPGPHDARFLFDEMVELGIKS
KAEKAN