Protein Info for MMJJ_RS06175 in Methanococcus maripaludis JJ

Annotation: DUF1743 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 301 TIGR03280: methanogenesis imperfect marker protein 11" amino acids 6 to 296 (291 residues), 466.7 bits, see alignment E=1.3e-144 PF22641: TiaS_TCKD" amino acids 141 to 206 (66 residues), 40.6 bits, see alignment E=2.8e-14 PF08489: TiaS_FLD" amino acids 174 to 238 (65 residues), 23.9 bits, see alignment E=3.8e-09

Best Hits

Swiss-Prot: 69% identical to Y921_METJA: Uncharacterized protein MJ0921 (MJ0921) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K06932, (no description) (inferred from 94% identity to mmq:MmarC5_1816)

Predicted SEED Role

"OB-fold nucleic acid binding domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (301 amino acids)

>MMJJ_RS06175 DUF1743 domain-containing protein (Methanococcus maripaludis JJ)
MTDYVSYKKIIAMVDEELGLTELVEEHPCPSGSEWLMYQYQRTSPVIVSSWRNGNKHHFI
LKNGKNDLNLVPSISAAGIEEVYLKDGNVHIVYAGLAGAGVGIELRKNAENVVAAELIEK
GGGSKLGRGMIQTPKMEKITVGIDDTDTKEEGATWVLANEIGNLIEESKMGFYIDHTITQ
LFPGNPNKTQNCVSIALTFAIYPEYKYKIGKEIEKLLKEKTLSEKTAIAIYRGLTPSQSM
KLYTMKAKREMVPINEAKMVAMRNNIEIIEVTGDGGIIGAVAALGLSECHKTAAKLPETY
E