Protein Info for MMJJ_RS06155 in Methanococcus maripaludis JJ

Annotation: phosphatidylglycerophosphatase A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 162 PF04608: PgpA" amino acids 95 to 160 (66 residues), 44.4 bits, see alignment E=8.4e-16

Best Hits

KEGG orthology group: None (inferred from 96% identity to mmx:MmarC6_1073)

Predicted SEED Role

"Predicted alpha-ribazole-5'-phosphate phosphatase CobZ (EC 3.1.3.73)" in subsystem Coenzyme B12 biosynthesis (EC 3.1.3.73)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.73

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (162 amino acids)

>MMJJ_RS06155 phosphatidylglycerophosphatase A (Methanococcus maripaludis JJ)
MTESLKNKCNSSNKNMLESDVVKLLSNLGVNFDNMLKCGMYMCICDESEKKEIETKFLEI
MKKQIKNPNVSTLLISAIVMDERGRNGGLPFDYDSDPTYVYADEVIGMAIANEIAGTKAT
FNFKWYDAKKPGVIGKLDKDGYMFLDDAVAGFVAGCMSKVFE