Protein Info for MMJJ_RS06115 in Methanococcus maripaludis JJ

Annotation: pyruvate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 447 PF00224: PK" amino acids 9 to 306 (298 residues), 261.1 bits, see alignment E=2.1e-81 TIGR01064: pyruvate kinase" amino acids 9 to 447 (439 residues), 413.8 bits, see alignment E=3.9e-128 PF03328: HpcH_HpaI" amino acids 151 to 224 (74 residues), 25.1 bits, see alignment E=1.5e-09 PF02887: PK_C" amino acids 338 to 444 (107 residues), 71.5 bits, see alignment E=9.5e-24

Best Hits

Swiss-Prot: 58% identical to KPYK_METJA: Pyruvate kinase (MJ0108) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K00873, pyruvate kinase [EC: 2.7.1.40] (inferred from 97% identity to mmp:MMP1605)

Predicted SEED Role

"Pyruvate kinase (EC 2.7.1.40)" in subsystem Entner-Doudoroff Pathway or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes or Pyruvate metabolism I: anaplerotic reactions, PEP (EC 2.7.1.40)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.40

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (447 amino acids)

>MMJJ_RS06115 pyruvate kinase (Methanococcus maripaludis JJ)
MVEKSTEYRKTKILVTMGPSLEGTFEKSLEFIDGIRFNMSHANIESIEKYLDTLNEKNIA
KLMDLKGNKIRIKKSNFSELIENQVVKLGKDILISYIPECIKKGQNILINDGKIKLIVES
VEKDITARVLVGGHIKEKMGVNFPEGCFPNDLTDEDIKNVKFAVENEFEYIALSFVRSET
DILNLKNLIKEYSGNCSVIAKIETKEGLKNIDEILNHSDGVMIARGDLGVEVAIEYLPII
QKNIIKLANEKGKLVITATQMLDSMVNNPYPTRAEVTDVANAIFDGTDCLMLSNETTIGK
YPIDSIKTLDNIAKVSEGDISKFKQEIEFEEHSIYSGIAYAVEALSKKLNPKIVITPTTS
GKTPLRISKFRFSSPIIALAPENIVFRKLRLVWGVIPKKIDEIGDVDEVLEISKKIAKNI
IGSGIYVVTLGHPKGEKKTNVIKVESI