Protein Info for MMJJ_RS06115 in Methanococcus maripaludis JJ

Annotation: pyruvate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01064: pyruvate kinase
  • amino acids 9 to 447 (439 residues), 413.8 bits, E=3.9e-128
• PF00224: PK
  • amino acids 9 to 306 (298 residues), 261.1 bits, E=2.1e-81
• PF03328: HpcH_HpaI
  • amino acids 151 to 224 (74 residues), 25.7 bits, E=9.9e-10
• PF02887: PK_C
  • amino acids 338 to 444 (107 residues), 73.3 bits, E=2.8e-24

Best Hits

Swiss-Prot: 58% identical to KPYK_METJA: Pyruvate kinase (MJ0108) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K00873, pyruvate kinase [EC: 2.7.1.40] (inferred from 97% identity to mmp:MMP1605)

Predicted SEED Role

"Pyruvate kinase (EC 2.7.1.40)" in subsystem Entner-Doudoroff Pathway or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes or Pyruvate metabolism I: anaplerotic reactions, PEP (EC 2.7.1.40)

MetaCyc Pathways

• glycolysis V (Pyrococcus) (10/10 steps found)
• glycolysis II (from fructose 6-phosphate) (9/11 steps found)
• Rubisco shunt (8/10 steps found)
• glycolysis IV (8/10 steps found)
• glycolysis I (from glucose 6-phosphate) (10/13 steps found)
• glycolysis III (from glucose) (8/11 steps found)
• homolactic fermentation (8/12 steps found)
• Bifidobacterium shunt (10/15 steps found)
• glycolysis VI (from fructose) (7/11 steps found)
• anaerobic energy metabolism (invertebrates, cytosol) (4/7 steps found)
• superpathway of anaerobic sucrose degradation (12/19 steps found)
• superpathway of glucose and xylose degradation (10/17 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (10/17 steps found)
• Entner-Doudoroff pathway I (4/9 steps found)
• Entner-Doudoroff pathway II (non-phosphorylative) (4/9 steps found)
• Entner-Doudoroff pathway III (semi-phosphorylative) (4/9 steps found)
• superpathway of hexitol degradation (bacteria) (10/18 steps found)
• glycerol degradation to butanol (8/16 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (12/22 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (9/19 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (14/26 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (14/27 steps found)
• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (13/26 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (6/17 steps found)
• superpathway of N-acetylneuraminate degradation (9/22 steps found)
• heterolactic fermentation (6/18 steps found)
• mixed acid fermentation (3/16 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Carbon fixation in photosynthetic organisms
• Glycolysis / Gluconeogenesis
• Purine metabolism
• Pyruvate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.40

Protein Sequence (447 amino acids)

>MMJJ_RS06115 pyruvate kinase (Methanococcus maripaludis JJ)
MVEKSTEYRKTKILVTMGPSLEGTFEKSLEFIDGIRFNMSHANIESIEKYLDTLNEKNIA
KLMDLKGNKIRIKKSNFSELIENQVVKLGKDILISYIPECIKKGQNILINDGKIKLIVES
VEKDITARVLVGGHIKEKMGVNFPEGCFPNDLTDEDIKNVKFAVENEFEYIALSFVRSET
DILNLKNLIKEYSGNCSVIAKIETKEGLKNIDEILNHSDGVMIARGDLGVEVAIEYLPII
QKNIIKLANEKGKLVITATQMLDSMVNNPYPTRAEVTDVANAIFDGTDCLMLSNETTIGK
YPIDSIKTLDNIAKVSEGDISKFKQEIEFEEHSIYSGIAYAVEALSKKLNPKIVITPTTS
GKTPLRISKFRFSSPIIALAPENIVFRKLRLVWGVIPKKIDEIGDVDEVLEISKKIAKNI
IGSGIYVVTLGHPKGEKKTNVIKVESI