Protein Info for MMJJ_RS06030 in Methanococcus maripaludis JJ

Annotation: 4Fe-4S binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 170 PF00037: Fer4" amino acids 49 to 68 (20 residues), 29 bits, see alignment (E = 2.6e-10) amino acids 87 to 109 (23 residues), 28.1 bits, see alignment (E = 5.3e-10) PF13237: Fer4_10" amino acids 50 to 105 (56 residues), 32.5 bits, see alignment E=2.7e-11 PF13187: Fer4_9" amino acids 52 to 106 (55 residues), 28.2 bits, see alignment E=6.5e-10 PF12838: Fer4_7" amino acids 52 to 106 (55 residues), 40.5 bits, see alignment E=1.2e-13

Best Hits

Swiss-Prot: 64% identical to Y1302_METJA: Uncharacterized polyferredoxin-like protein MJ1302 (MJ1302) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K14121, energy-converting hydrogenase B subunit L (inferred from 95% identity to mmq:MmarC5_1786)

Predicted SEED Role

"Energy conserving hydrogenase Ehb ferredoxin-containing protein L"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (170 amino acids)

>MMJJ_RS06030 4Fe-4S binding protein (Methanococcus maripaludis JJ)
MTLKGLTKVFISGFYENLERIILGSDRYTSKEMTAEILKGIELPSSVFSEICIGCGGCKN
ACPTNAIEMIPVEPVKITETYSKEAIPKIDYDKCVYCLYCHDFCPVFALFNEVSPIHPRH
VGEDIVLVDLSKLLEKPIEIPEEQLSKIAKILSINISGIVKREKKANSKV