Protein Info for MMJJ_RS06025 in Methanococcus maripaludis JJ

Annotation: 4Fe-4S binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF12800: Fer4_4
  • amino acids 44 to 58 (15 residues), 13.6 bits, see alignment (E = 4.9e-05)
  • amino acids 74 to 86 (13 residues), 17.2 bits, see alignment (E = 3.4e-06)
  • amino acids 105 to 119 (15 residues), 12.3 bits, see alignment (E = 0.00013)
  • amino acids 179 to 193 (15 residues), 15.8 bits, see alignment (E = 9.6e-06)
  • amino acids 226 to 241 (16 residues), 13.9 bits, see alignment (E = 4.1e-05)
  • amino acids 265 to 277 (13 residues), 16.4 bits, see alignment (E = 6e-06)
  • amino acids 292 to 308 (17 residues), 12.3 bits, see alignment (E = 0.00013)
  • amino acids 351 to 364 (14 residues), 10.5 bits, see alignment (E = 0.00047)
  • amino acids 430 to 442 (13 residues), 12.7 bits, see alignment (E = 9.5e-05)
• PF14697: Fer4_21
  • amino acids 44 to 91 (48 residues), 35.3 bits, 6.8e-12
• PF12838: Fer4_7
  • amino acids 44 to 88 (45 residues), 31.2 bits, 1.6e-10
  • amino acids 75 to 120 (46 residues), 31.9 bits, 9.4e-11
  • amino acids 228 to 280 (53 residues), 41.4 bits, 1.1e-13
  • amino acids 265 to 309 (45 residues), 36.3 bits, 4.1e-12
  • amino acids 321 to 366 (46 residues), 33.2 bits, 3.9e-11
  • amino acids 352 to 405 (54 residues), 31.3 bits, 1.5e-10
  • amino acids 390 to 444 (55 residues), 28.3 bits, 1.3e-09
• PF12798: Fer4_3
  • amino acids 45 to 59 (15 residues), 13.1 bits, see alignment (E = 9.7e-05)
  • amino acids 75 to 88 (14 residues), 13.5 bits, see alignment (E = 7.5e-05)
  • amino acids 106 to 120 (15 residues), 14.1 bits, see alignment (E = 4.7e-05)
  • amino acids 181 to 194 (14 residues), 15.3 bits, see alignment (E = 2e-05)
  • amino acids 205 to 219 (15 residues), 13.3 bits, see alignment (E = 8.5e-05)
  • amino acids 229 to 243 (15 residues), 13 bits, see alignment (E = 0.0001)
  • amino acids 266 to 280 (15 residues), 16.7 bits, see alignment (E = 7.2e-06)
  • amino acids 430 to 444 (15 residues), 13.7 bits, see alignment (E = 6.6e-05)
• PF00037: Fer4
  • amino acids 45 to 61 (17 residues), 23.7 bits, see alignment (E = 2.1e-08)
  • amino acids 68 to 90 (23 residues), 25.8 bits, see alignment (E = 4.6e-09)
  • amino acids 175 to 196 (22 residues), 25.9 bits, see alignment (E = 4.1e-09)
  • amino acids 226 to 245 (20 residues), 23.3 bits, see alignment (E = 2.8e-08)
  • amino acids 265 to 281 (17 residues), 26.1 bits, see alignment (E = 3.5e-09)
  • amino acids 290 to 309 (20 residues), 21.2 bits, see alignment (E = 1.3e-07)
  • amino acids 347 to 368 (22 residues), 31.1 bits, see alignment (E = 9.8e-11)
  • amino acids 424 to 446 (23 residues), 24 bits, see alignment (E = 1.7e-08)
  • amino acids 450 to 471 (22 residues), 25 bits, see alignment (E = 8.2e-09)
• PF13237: Fer4_10
  • amino acids 69 to 117 (49 residues), 29 bits, 5.4e-10
  • amino acids 105 to 192 (88 residues), 26.6 bits, E=2.9e-09
  • amino acids 226 to 277 (52 residues), 28.8 bits, 6.3e-10
  • amino acids 261 to 306 (46 residues), 28.7 bits, 6.5e-10
  • amino acids 319 to 363 (45 residues), 28 bits, 1.1e-09
• PF13187: Fer4_9
  • amino acids 75 to 120 (46 residues), 28.8 bits, 6.8e-10
  • amino acids 228 to 280 (53 residues), 33.9 bits, 1.7e-11
  • amino acids 321 to 367 (47 residues), 31.2 bits, 1.2e-10
• PF13183: Fer4_8
  • amino acids 105 to 194 (90 residues), 27.1 bits, E=3.3e-09

Best Hits

KEGG orthology group: K14120, energy-converting hydrogenase B subunit K (inferred from 94% identity to mmp:MMP1624)

Predicted SEED Role

"Energy conserving hydrogenase Ehb polyferredoxin (protein K)"

Protein Sequence (481 amino acids)

>MMJJ_RS06025 4Fe-4S binding protein (Methanococcus maripaludis JJ)
MIVTDIKKCRTYEECENCKSKEISKCMEVCPTNAIKMIDGKAFSCITCGTCAKECPTGAI
KKNEYGGYYVNRKLCTGCGICKNACPIDIIDIREDSTGKAYPTGMCVMCGLCTTECPYNA
RLYFDPSSLKNTKNKMLMERYSTIFKMMGKTYEFPEQKHVKIVKPTERMLRHSISIDSEK
CVECGKCIYVCPKDTIIEAEIVDGCTRCNICNEVCPVDAIKYGEVTENCILCGNCISKCP
KDALEISEFKVVKTKEDVKANPEKHCINCGLCVDKCPSNALRFENGKILYDPKTCTLCNT
CVKECPQGVRINKGGFVDGGCVLCEVCIKECPEDAISIKERSKFTSIDKKECIACGTCSM
VCPNDAITVKIDSLNFSGNKVHSEVIFNDNCVLCEKCAIHCPRDVIENTSGYKKVVDPEN
SYIRVDDGYCVKCGLCTIICPNDAIDKGEITTERCEYCSACVNICPTRAIRIYRTWNEKT
K