Protein Info for MMJJ_RS05965 in Methanococcus maripaludis JJ

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 456 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 42 to 62 (21 residues), see Phobius details amino acids 74 to 97 (24 residues), see Phobius details amino acids 99 to 100 (2 residues), see Phobius details amino acids 104 to 126 (23 residues), see Phobius details amino acids 133 to 157 (25 residues), see Phobius details amino acids 163 to 182 (20 residues), see Phobius details amino acids 194 to 214 (21 residues), see Phobius details amino acids 220 to 236 (17 residues), see Phobius details amino acids 257 to 282 (26 residues), see Phobius details amino acids 293 to 310 (18 residues), see Phobius details amino acids 322 to 341 (20 residues), see Phobius details amino acids 347 to 365 (19 residues), see Phobius details amino acids 386 to 411 (26 residues), see Phobius details amino acids 423 to 447 (25 residues), see Phobius details PF07690: MFS_1" amino acids 13 to 184 (172 residues), 116.6 bits, see alignment E=1.3e-37 amino acids 262 to 444 (183 residues), 57.4 bits, see alignment E=1.2e-19 PF00083: Sugar_tr" amino acids 21 to 177 (157 residues), 29.5 bits, see alignment E=3.8e-11

Best Hits

KEGG orthology group: None (inferred from 97% identity to mmp:MMP1636)

Predicted SEED Role

"Efflux pump antibiotic resistance protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (456 amino acids)

>MMJJ_RS05965 MFS transporter (Methanococcus maripaludis JJ)
MKNEKSIVAVVAAISSFLTPFMSTALNLALPSIGTEFSADTILLSWLVTSFLLASSALLL
PFGRIADIIGRKRILLNGLLIFGLSSLMGIFSGSITHLILLRILQGIGSAMIFGTAIAIL
TSFYPLNERGKALGINIATVYIGLSLGPFLGGILTHYFGWRSIFLFSGIIGILTYIIAKK
FVLNEWCDAKGETFDYFGSITYIISLVFLVYGFITFSSGGSIFILVSLLFGSIFIHREHK
TENPILNIKLITKNLAFSMSNLAALLNYGATYAVAFLISFYLQSLRGFSAQDAGIILLAQ
PLVQAIFSPITGKLSDKIEPRILASLGMGITCSGLVLFSFIKLDTSIYQIILNLMLLGFG
FALFSSPNTNAIMSSVERKFAGVASAMLATVRILGQMTSMAIITVLIAFYVGNNPISAEF
SPLFLQGITASFKVSAILCLFGIFASLARKNIRNQN