Protein Info for MMJJ_RS05935 in Methanococcus maripaludis JJ

Annotation: Era-like GTP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 184 TIGR00231: small GTP-binding protein domain" amino acids 5 to 175 (171 residues), 63.5 bits, see alignment E=1e-21 PF01926: MMR_HSR1" amino acids 7 to 136 (130 residues), 68.9 bits, see alignment E=1.1e-22 PF02421: FeoB_N" amino acids 7 to 178 (172 residues), 48.3 bits, see alignment E=2.1e-16 PF04670: Gtr1_RagA" amino acids 7 to 160 (154 residues), 28.5 bits, see alignment E=2.6e-10 PF00009: GTP_EFTU" amino acids 94 to 182 (89 residues), 27.1 bits, see alignment E=7.4e-10

Best Hits

Swiss-Prot: 61% identical to Y920_METJA: Uncharacterized protein MJ0920 (MJ0920) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K06883, (no description) (inferred from 100% identity to mmp:MMP1642)

Predicted SEED Role

"GTP-binding protein Era" in subsystem Bacterial Cell Division or Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (184 amino acids)

>MMJJ_RS05935 Era-like GTP-binding protein (Methanococcus maripaludis JJ)
MEEHQFKIALVGPENSGKSSLVNSIFGKNISEVSEVGGTTKMPVKKFWGKIKIGKQKINP
DFAKITFVDLGGLYAGENRSVVMVGSVLEKTYEEIDDSDLIIHIIDGSTDLFKSFEKLHH
LLKFRYRKPIIVVINKCDLIENSKREDLRKYVEGRLENKVFFTSSNTYEGIGELLSTIIE
ILRR