Protein Info for MMJJ_RS05915 in Methanococcus maripaludis JJ

Annotation: multiprotein bridging factor aMBF1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 158 TIGR00270: TIGR00270 family protein" amino acids 1 to 156 (156 residues), 136.1 bits, see alignment E=4.3e-44 PF12844: HTH_19" amino acids 75 to 122 (48 residues), 34.7 bits, see alignment E=2.2e-12 PF01381: HTH_3" amino acids 78 to 130 (53 residues), 45.4 bits, see alignment E=1e-15 PF13413: HTH_25" amino acids 79 to 112 (34 residues), 25.2 bits, see alignment 1.7e-09

Best Hits

Swiss-Prot: 48% identical to Y586_METJA: Uncharacterized HTH-type transcriptional regulator MJ0586 (MJ0586) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K03627, putative transcription factor (inferred from 98% identity to mmp:MMP1646)

Predicted SEED Role

"Uncharacterized HTH-type transcriptional regulator MJ0586"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (158 amino acids)

>MMJJ_RS05915 multiprotein bridging factor aMBF1 (Methanococcus maripaludis JJ)
MQCELCGKEVTNIIKTRVEGVEMNVCEACAKFGMSPKGYSRKPKAVFKNETKQKQAKRPR
RDMFDNLKTLVEDYGSLVKEAREKKNMTLEELSRAVGIKESLIHKIERNEIEPEEKYVKI
LEKELGISFYEEGDLNYETSNEDSEFTLGDFIKVKKRK