Protein Info for MMJJ_RS05900 in Methanococcus maripaludis JJ

Annotation: ATP-binding cassette domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 353 PF00005: ABC_tran" amino acids 18 to 160 (143 residues), 113 bits, see alignment E=2.6e-36 PF03459: TOBE" amino acids 289 to 350 (62 residues), 36.2 bits, see alignment E=8.7e-13

Best Hits

Swiss-Prot: 36% identical to POTA_THEMA: Spermidine/putrescine import ATP-binding protein PotA (potA) from Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099)

KEGG orthology group: K02017, molybdate transport system ATP-binding protein [EC: 3.6.3.29] (inferred from 98% identity to mmp:MMP1649)

Predicted SEED Role

"Molybdenum transport ATP-binding protein ModC (TC 3.A.1.8.1)" in subsystem Molybdenum cofactor biosynthesis or Transport of Molybdenum (TC 3.A.1.8.1)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.29

Use Curated BLAST to search for 3.6.3.29

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (353 amino acids)

>MMJJ_RS05900 ATP-binding cassette domain-containing protein (Methanococcus maripaludis JJ)
MSFVKIENLNINLGEFKLEDVNLSVEKGDYVTIIGPTGSGKSILLETALGFYTPETGKIF
LEEKEITNLNPEKRDISIIYQDYALFPHMTVYENIEYGLKKRLNDKKAIKEEILQITKML
GIDHLLNRKPETLSGGEMQRASIARGLIIKPKILFMDEPFSALDVKTKEKIRILVKTAIK
KYGTTVLHVTHDFEDIWSLADKVLIMKGGRVYQYGTPEEVFSNPSSEIVADFVGTNILDS
KVEEISGNISILDVSGVKIYSSDIAKVGENVKVSIRPENIIVALKCFDSSAKNVFNGKVT
EIKKRGHLVWLTLDIGGVDLKVLVTPNSLEALEIEENKNLCVMFKATGVKIIR