Protein Info for MMJJ_RS05885 in Methanococcus maripaludis JJ

Annotation: tungstate ABC transporter substrate-binding protein WtpA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03730: tungstate ABC transporter binding protein WtpA
  • amino acids 39 to 311 (273 residues), 428.3 bits, E=5.2e-133
• PF13531: SBP_bac_11
  • amino acids 40 to 312 (273 residues), 76.1 bits, E=3.8e-25
• PF01547: SBP_bac_1
  • amino acids 55 to 313 (259 residues), 39.2 bits, E=8.4e-14

Best Hits

Swiss-Prot: 99% identical to Y1652_METMP: Uncharacterized solute-binding protein MMP1652 (MMP1652) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K02061, putative sulfate transport system substrate-binding protein (inferred from 99% identity to mmp:MMP1652)

Predicted SEED Role

"Tungstate ABC transporter, periplasmic substrate-binding protein WtpA"

Protein Sequence (346 amino acids)

>MMJJ_RS05885 tungstate ABC transporter substrate-binding protein WtpA (Methanococcus maripaludis JJ)
MKKSLNIVAMFGILMILAFSGCVDQSASDSTSEDATPKVLKIFHAGSLAVPFGEYETLYE
NEYTNVDVQRESAGSVACVRKITELNKTAEILASADYTLIPSMMMPDYADWYIMVAKNEI
VIAYTENSQYYDEITSDNWYEIFQRDGVKYGFSSPNDDPCGYRSQMVVQLAEAAYGDSTI
YDNLMLGNTNFEVNENADGTYCIVSPESIDVNEAKVFMRSKEVDLLGPLETGAYDYLFIY
KSVANQHNLSYIELPEDINLGDYQNADEYAKASIFLTGQNKTIVAKPIVYGMTVPSNAED
YEEGVNFVKTVLEHPEVFENAGQPVISPAIAVGDVPEEISDLVVMG