Protein Info for MMJJ_RS05870 in Methanococcus maripaludis JJ
Annotation: pyridoxal 5'-phosphate synthase glutaminase subunit PdxT
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 99% identical to PDXT_METMP: Pyridoxal 5'-phosphate synthase subunit PdxT (pdxT) from Methanococcus maripaludis (strain S2 / LL)
KEGG orthology group: K08681, glutamine amidotransferase [EC: 2.6.-.-] (inferred from 99% identity to mmp:MMP1656)MetaCyc: 42% identical to 2-deoxy-scyllo-inosose synthase 23 kDa subunit (Niallia circulans)
Predicted SEED Role
"Pyridoxine biosynthesis glutamine amidotransferase, glutaminase subunit (EC 2.4.2.-)" in subsystem Pyridoxin (Vitamin B6) Biosynthesis (EC 2.4.2.-)
KEGG Metabolic Maps
- Biosynthesis of alkaloids derived from histidine and purine
- Biosynthesis of plant hormones
- Ether lipid metabolism
- Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
- Purine metabolism
- Vitamin B6 metabolism
Isozymes
Compare fitness of predicted isozymes for: 2.4.2.-
Use Curated BLAST to search for 2.4.2.- or 2.6.-.-
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (archaea)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (187 amino acids)
>MMJJ_RS05870 pyridoxal 5'-phosphate synthase glutaminase subunit PdxT (Methanococcus maripaludis JJ) MKIIGILGIQGDIEEHEDAVKKINCIPKRIRTVDDLEGIDALIIPGGESTTIGKLMVSYG FIDKIRNLKIPILGTCAGMVLLSKGTGKEQPLLEMLNVTIKRNAYGSQKDSFEKEIDLGG KKINAVFIRAPQVGEILSKDVEIISKDDENIVGIKEGNIMAISFHPELSDDGVIAYEYFL KNIVEKK