Protein Info for MMJJ_RS05800 in Methanococcus maripaludis JJ

Annotation: coenzyme F420-0:L-glutamate ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 transmembrane" amino acids 190 to 190 (1 residues), see Phobius details amino acids 193 to 215 (23 residues), see Phobius details PF01996: F420_ligase" amino acids 17 to 206 (190 residues), 111.7 bits, see alignment E=1.9e-36

Best Hits

Swiss-Prot: 58% identical to Y1361_METJA: Uncharacterized protein MJ1361 (MJ1361) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: None (inferred from 97% identity to mmx:MmarC6_1009)

Predicted SEED Role

"Uncharacterized protein MJ1361"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (298 amino acids)

>MMJJ_RS05800 coenzyme F420-0:L-glutamate ligase (Methanococcus maripaludis JJ)
MEIVLIREKMEINATPIRTRYIDRNEDFVSESINSLKNEIENGFEIKNGDFLVVSEKFIA
TSEDNFVDESLANPKFWAYFTYYLSKYGWGYVLGPLLGTRGDRVKNLRKMPKTETLKHKQ
IVIENVGLIYALKPASEGGIDLTNVPGTYASLLPEKPENSAKKLHKKIKEELNLDLTVMV
IDTDATYRFFNWYVTALPIAIDGIISKIGVFGYILGKFGKILKQGGLCGATPLAIVGNEN
YKKYPLKTILYIANLSDTSQVPYTKSIHDLMKKYNTFEITVDVLKEMEHSPLVIVKCE