Protein Info for MMJJ_RS05785 in Methanococcus maripaludis JJ

Annotation: flagellin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 216 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details TIGR02537: archaeal flagellin N-terminal-like domain" amino acids 10 to 33 (24 residues), 28.1 bits, see alignment (E = 5.9e-11) PF01917: Arch_flagellin" amino acids 12 to 202 (191 residues), 157.5 bits, see alignment E=1.7e-50

Best Hits

Swiss-Prot: 67% identical to FLAB2_METVO: Flagellin B2 (flaB2) from Methanococcus voltae

KEGG orthology group: K07325, archaeal flagellin FlaB (inferred from 97% identity to mmp:MMP1667)

Predicted SEED Role

"Flagellin FlaB2" in subsystem Archaeal Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (216 amino acids)

>MMJJ_RS05785 flagellin (Methanococcus maripaludis JJ)
MKITEFMKNKKGASGIGTLIVFIAMVLVAAVAASVLINTSGYLQQKASTTGKDSTEQVAS
GLQIMGISGYQDGSAGANITKLAIYITPNAGSAAIDMNQVVLTLSDGSTKTVTKYDTTAY
TNLTAGGDLYNTTTVNWSKLADTTEFGIVEIQDADLSFTSSAPVINKGDIVAIIVSGVSF
DTRMEISGSVQPEFGAPGVISFTTPSTFTEKVVSLQ