Protein Info for MMJJ_RS05780 in Methanococcus maripaludis JJ

Annotation: flagellin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 210 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details TIGR02537: archaeal flagellin N-terminal-like domain" amino acids 9 to 32 (24 residues), 22.5 bits, see alignment (E = 3.4e-09) PF01917: Arch_flagellin" amino acids 11 to 196 (186 residues), 135.9 bits, see alignment E=7.8e-44

Best Hits

Swiss-Prot: 68% identical to FLAB3_METVS: Flagellin B3 (flaB3) from Methanococcus vannielii (strain ATCC 35089 / DSM 1224 / JCM 13029 / OCM 148 / SB)

KEGG orthology group: K07325, archaeal flagellin FlaB (inferred from 90% identity to mmp:MMP1668)

Predicted SEED Role

"Flagellin FlaB3" in subsystem Archaeal Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (210 amino acids)

>MMJJ_RS05780 flagellin (Methanococcus maripaludis JJ)
MVKKFMKNKKGAVGIGTLIIFIAMVLVAAIAASVIINTAGKLQHKASTVGEESTEQVASG
IQVLKVIGHATDKTTIDKLAVMVTPNVGGEIDLSTTILTLSTGDAKYSLVYDSAQHNAVV
KDAGSDSIFDETEWGTDTKYGVIVLQDSDNSTTDSTHPTINYGDKVYLTVTMDVASTSKV
SGEVIPEYGASGIVEFRAPSVFTENVTTLQ