Protein Info for MMJJ_RS05740 in Methanococcus maripaludis JJ

Annotation: archaellar assembly protein FlaJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 558 transmembrane" amino acids 20 to 39 (20 residues), see Phobius details amino acids 45 to 64 (20 residues), see Phobius details amino acids 194 to 215 (22 residues), see Phobius details amino acids 221 to 242 (22 residues), see Phobius details amino acids 268 to 286 (19 residues), see Phobius details amino acids 298 to 318 (21 residues), see Phobius details amino acids 443 to 465 (23 residues), see Phobius details amino acids 495 to 515 (21 residues), see Phobius details amino acids 527 to 547 (21 residues), see Phobius details PF00482: T2SSF" amino acids 80 to 206 (127 residues), 37.5 bits, see alignment E=1.1e-13

Best Hits

Swiss-Prot: 72% identical to FLAJ_METVO: Flagella accessory protein J (flaJ) from Methanococcus voltae

KEGG orthology group: K07333, archaeal flagellar protein FlaJ (inferred from 100% identity to mmp:MMP1676)

Predicted SEED Role

"Flagella-related protein FlaJ" in subsystem Archaeal Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (558 amino acids)

>MMJJ_RS05740 archaellar assembly protein FlaJ (Methanococcus maripaludis JJ)
MFFDILPRVGLKPKDYILKFILPASIISILLLILGITYFSGYTRLVVLFLPLLLMGSAIG
YPYIELDSQRQKINERLHIFITKFGVLSITDLDRKELMHLLATEKEELGQLATESHKIFV
LIKRWNQSLAESCRFLANRSPSSQFGDFLDRMAYSIDSGQELKEFLHGEQDIVMEDYGEF
YKRAIYTLDTFKEMYVSAVTSVSFFVTFAIIAPFLLPYDFVTMVTVALLGFVLIEVLLVY
AIKSRLPYDRLWHTGEKPTKIDLKLKKWLIISVIGTVLFTLFLLWGKFIGEIPQIMKIPY
QIIFALGMSPLAIGGYFAQREENLVIRKEFNFPDFLRSLGDSVSAKGGGMTDSLEYLSSN
DFGPLTKDLEGLYKRVSIRVNSQKAWRYFGYDTCSYMIQLFSEMFERCTFLGGNAGVAAH
MIGKNFRKIINLRKAKYQSVSQFSGIMYGLAGGMALTLYASAGVANMVNGLYTSLDIPDT
MISIVNIITPEDFSLIAYLIYGVLVIYSIVSGYLIKLMDGGHYQVSLMHFVIMLWVASIV
GYIAEVMTGSLLGTSLPI