Protein Info for MMJJ_RS05675 in Methanococcus maripaludis JJ

Annotation: RNA-guided pseudouridylation complex pseudouridine synthase subunit Cbf5

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 TIGR00425: putative rRNA pseudouridine synthase" amino acids 2 to 318 (317 residues), 489 bits, see alignment E=5.8e-151 PF08068: DKCLD" amino acids 2 to 46 (45 residues), 58.6 bits, see alignment 1.3e-19 PF01509: TruB_N" amino acids 51 to 163 (113 residues), 80.7 bits, see alignment E=3.7e-26 PF21238: Pus10_C" amino acids 92 to 169 (78 residues), 29.7 bits, see alignment E=1.2e-10 PF16198: TruB_C_2" amino acids 165 to 230 (66 residues), 87.5 bits, see alignment E=1.4e-28 TIGR00451: uncharacterized domain 2" amino acids 231 to 304 (74 residues), 31.9 bits, see alignment E=1.2e-11 PF01472: PUA" amino acids 234 to 307 (74 residues), 65.5 bits, see alignment E=8.6e-22

Best Hits

Swiss-Prot: 98% identical to TRUB_METM5: Probable tRNA pseudouridine synthase B (truB) from Methanococcus maripaludis (strain C5 / ATCC BAA-1333)

KEGG orthology group: K03177, tRNA pseudouridine synthase B [EC: 5.4.99.12] (inferred from 98% identity to mmx:MmarC6_0985)

Predicted SEED Role

"tRNA pseudouridine 55 synthase (EC 4.2.1.70)" in subsystem tRNA processing (EC 4.2.1.70)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.70, 5.4.99.12

Use Curated BLAST to search for 4.2.1.70 or 5.4.99.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (333 amino acids)

>MMJJ_RS05675 RNA-guided pseudouridylation complex pseudouridine synthase subunit Cbf5 (Methanococcus maripaludis JJ)
MELIVKEESKTDYNYGSDPYNRDIKTLLNTGLVVIDKPSGPTSHEVAAWVRNMLNLVKAG
HGGTLDPKVTGALPVALGNTTKCVPIWHIPPKEYVCLMHLHDDAKFSDIEKIFKEFTGRI
HQRPPLKAAVKRSLRIRKIYEIEILEIDGRDILFRTKCQSGTYLRKLVDDMGEALGTSAH
MQELRRTISGPFYENEAVYLQDLLDAYIFWKEDGNEEELRKLVKPLEYGLQHLKKIIVKD
SAVDAVCHGATLYSSGVSKIEKGIGTDEIVLIETLKGEAVAVGKPLMNTKDMLKTEEGEV
VEITRVIMEPGIYPRIWKKRNKNNKNKPESKKK