Protein Info for MMJJ_RS05660 in Methanococcus maripaludis JJ

Annotation: sulfopyruvate decarboxylase subunit beta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 185 TIGR03846: sulfopyruvate decarboxylase, beta subunit" amino acids 5 to 184 (180 residues), 259.1 bits, see alignment E=1.1e-81 PF02775: TPP_enzyme_C" amino acids 43 to 154 (112 residues), 58.1 bits, see alignment E=4.6e-20

Best Hits

Swiss-Prot: 97% identical to COME_METMP: Sulfopyruvate decarboxylase subunit beta (comE) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K13039, sulfopyruvate decarboxylase subunit beta [EC: 4.1.1.79] (inferred from 97% identity to mmp:MMP1689)

MetaCyc: 55% identical to beta subunit of sulfopyruvate decarboxylase (Methanocaldococcus jannaschii)
Sulfopyruvate decarboxylase. [EC: 4.1.1.79]

Predicted SEED Role

"Sulfopyruvate decarboxylase - beta subunit (EC 4.1.1.79)" (EC 4.1.1.79)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.79

Use Curated BLAST to search for 4.1.1.79

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (185 amino acids)

>MMJJ_RS05660 sulfopyruvate decarboxylase subunit beta (Methanococcus maripaludis JJ)
MELTRYEIIKILMEYVTDEIVVCNIGIPSKELFKINDREKNFYMLGSMGLSSSIGHGLAL
SVNEKVIAIDGDGSVLMNMGSLATIGKTAPKDFLLLIVDNCAYGSTGNQETHSTCTDLYQ
VSKACGIDSIGVFNEEQLREAVKLVLTESGTKVIIAKARPHNENVPNINLVPTEIKHRFM
NSIKK