Protein Info for MMJJ_RS05600 in Methanococcus maripaludis JJ

Annotation: sodium:solute symporter family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 533 transmembrane" amino acids 6 to 22 (17 residues), see Phobius details amino acids 43 to 66 (24 residues), see Phobius details amino acids 73 to 93 (21 residues), see Phobius details amino acids 124 to 149 (26 residues), see Phobius details amino acids 155 to 174 (20 residues), see Phobius details amino acids 185 to 203 (19 residues), see Phobius details amino acids 245 to 263 (19 residues), see Phobius details amino acids 283 to 304 (22 residues), see Phobius details amino acids 346 to 367 (22 residues), see Phobius details amino acids 391 to 412 (22 residues), see Phobius details amino acids 422 to 442 (21 residues), see Phobius details amino acids 449 to 470 (22 residues), see Phobius details amino acids 500 to 518 (19 residues), see Phobius details PF00474: SSF" amino acids 34 to 457 (424 residues), 206.7 bits, see alignment E=3e-65 TIGR00813: transporter, solute:sodium symporter (SSS) family" amino acids 34 to 457 (424 residues), 206.9 bits, see alignment E=2.7e-65

Best Hits

KEGG orthology group: K03307, solute:Na+ symporter, SSS family (inferred from 99% identity to mmp:MMP1700)

Predicted SEED Role

"Sodium/proline symporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (533 amino acids)

>MMJJ_RS05600 sodium:solute symporter family protein (Methanococcus maripaludis JJ)
MNILLLNVIVLIYLLVIGYLGYKGWKGTSSAEDYMVGGRKIHPFVMAMSYGATFISTAAI
VGFGGFSGLFGMSLLWLTFLNIFLGIFIAFVFFGKRTRKMGHNLNALTFPELLAKRFESK
FIQWFSGLLIFCAMPIYAAAVLIGAARFIETTLNISFDVALLVFSIIIAVYVVMGGLKGV
MYTDAFQGTIMFFGMLFLLYMTYDILGGVTTAHQAISNMSGLVPANLASVGHAGWTSMPT
FGSPMWWTIVSSIILGVGIGVLAQPQLIVRFMTVKSNRELNRAVLIGAVFILIATGTAYV
VGTLSNVYFMNTEGVLSIGATVSETFPTGNSDSIMPLYINKAMPEWFIYIFLVSLLAAAM
STISSQFHAQGTSIGRDVYETICGKKGLNSVIITRLGIIVAIVIAAILGYILPGGIVARG
TALFFGLCSAAFLPAYALGLFWKRTTKEGAIAGLLTGTFVSLFCLVFVHQAESAALGISK
MLIGRDVLISAMPWPYVDPMVISLPLAFIATVLVSLLTKAPSKEHLKKCFKGI