Protein Info for MMJJ_RS05540 in Methanococcus maripaludis JJ

Annotation: LysR family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 PF00126: HTH_1" amino acids 8 to 63 (56 residues), 60.9 bits, see alignment E=9.5e-21 PF03466: LysR_substrate" amino acids 89 to 293 (205 residues), 137.2 bits, see alignment E=5.3e-44

Best Hits

Swiss-Prot: 70% identical to Y300_METJA: Uncharacterized HTH-type transcriptional regulator MJ0300 (MJ0300) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: None (inferred from 100% identity to mmp:MMP1712)

Predicted SEED Role

"LysR family transcriptional regulator YeiE" in subsystem YeiH

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (296 amino acids)

>MMJJ_RS05540 LysR family transcriptional regulator (Methanococcus maripaludis JJ)
MDPKISYFQTFLFAAKTKSFSKAAKKLGVTQGTVSNHISVLEKFFDAQLFLRTPEGVDLT
TEGNILYENAEKLLENISNAKQQMRILHEHPEGLIRIAASTTPGEHLLPSIIKDYTKVYR
DVSFQIQITDSEKCFKLLEDRAVDIIAVGNIYDGSYESEVIGKDRLVLVVPPEHELAKKG
VAKLSDILKEDYIDREVGSGTREIFVDALQDKGYSMMDLHTIMSLGSNSSIITAVSEGYG
ISIISEIPAKKAADAGQLKIVPIEDLDLTRYMYLVKGKKPRNPSAIKSFWDFVSGK