Protein Info for MMJJ_RS05515 in Methanococcus maripaludis JJ

Annotation: class I SAM-dependent methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 360 PF01209: Ubie_methyltran" amino acids 168 to 317 (150 residues), 32.5 bits, see alignment E=2.6e-11 PF13489: Methyltransf_23" amino acids 185 to 318 (134 residues), 34.1 bits, see alignment E=9.8e-12 PF01135: PCMT" amino acids 189 to 254 (66 residues), 28.2 bits, see alignment E=7.1e-10 PF05175: MTS" amino acids 190 to 322 (133 residues), 24.3 bits, see alignment E=9.3e-09 PF13847: Methyltransf_31" amino acids 196 to 316 (121 residues), 60.1 bits, see alignment E=1e-19 PF13649: Methyltransf_25" amino acids 201 to 295 (95 residues), 43.3 bits, see alignment E=2.2e-14 PF08242: Methyltransf_12" amino acids 202 to 297 (96 residues), 48.1 bits, see alignment E=7.3e-16 PF08241: Methyltransf_11" amino acids 202 to 299 (98 residues), 47.3 bits, see alignment E=1.2e-15

Best Hits

Swiss-Prot: 47% identical to Y906_METJA: Uncharacterized protein MJ0906 (MJ0906) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K00599, [EC: 2.1.1.-] (inferred from 99% identity to mmp:MMP1717)

Predicted SEED Role

"Methyltransferase MJ0906"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (360 amino acids)

>MMJJ_RS05515 class I SAM-dependent methyltransferase (Methanococcus maripaludis JJ)
MAFNIDGSGNKSGVRSNMLSENNILKYGSNFSKANASSLNNKINSLNYTVEYINNELMGI
FFRQGLKFGIFKAVEDFRPTISELITILGYPNEEFVEKYIKTAVSLNLLNLNEEERLELN
SDFIYSSIHPEYDKIISDHVSKYDFMSGLVQYAFIGYDHPEILLNFKKDADIWDMMLNTK
YMKICREVISEYLDIKNGDTILEVGCGSRSPLYFASKVAPNGEYVGVDISKKLIRVAKGR
LKRSGIECAKLKALDFSETIAKNKHDYVLCIHTLSYADSLKLFLKKMTGSLRKGGKLVIM
EEFFTENINTNAELFEFYNHLNKYFKNYVSKTEILKELELIGIDYKYELLGDNCIVVERI