Protein Info for MMJJ_RS05490 in Methanococcus maripaludis JJ

Annotation: imidazole glycerol phosphate synthase subunit HisF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00735: imidazoleglycerol phosphate synthase, cyclase subunit
  • amino acids 1 to 271 (271 residues), 400.5 bits, E=1.3e-124
• PF00977: His_biosynth
  • amino acids 5 to 254 (250 residues), 281.6 bits, E=8.9e-88

Best Hits

Swiss-Prot: 99% identical to HIS6_METMP: Imidazole glycerol phosphate synthase subunit HisF (hisF) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K02500, cyclase [EC: 4.1.3.-] (inferred from 99% identity to mmp:MMP1722)

Predicted SEED Role

"Imidazole glycerol phosphate synthase cyclase subunit (EC 4.1.3.-)" in subsystem Histidine Biosynthesis (EC 4.1.3.-)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (35/46 steps found)
• L-histidine biosynthesis (9/10 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of plant hormones
• Pyruvate metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.1.3.-

Use Curated BLAST to search for 4.1.3.-

Protein Sequence (272 amino acids)

>MMJJ_RS05490 imidazole glycerol phosphate synthase subunit HisF (Methanococcus maripaludis JJ)
MLTKRIIPCLDIKEGRVVKGTNFVELRDAGDPVELSKIYNEQGADELVFLDITASFEKRD
IIIDVVKRTAEQVFIPLTVGGGIKTVDDFRKILRAGADKISINTSAVKTPELIKEASEIF
GTQCVVVAMDVKRKYITDSQDANLKDKNIFETKLGSCWFEVYIYGGREGTGIDAIEWAKK
VEYLGAGEILLTSMDADGTKDGYDLVLTKAISENTKLPIIASGGCGNANHVVDAFTEGKA
DAALMASILHYRECTVNDLKKEVEKNNIPVRF