Protein Info for MMJJ_RS05415 in Methanococcus maripaludis JJ

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04104: DNA_primase_lrg
  • amino acids 122 to 364 (243 residues), 100.7 bits, E=4.9e-33

Best Hits

KEGG orthology group: K02685, DNA primase large subunit [EC: 2.7.7.-] (inferred from 86% identity to mmp:MMP0009)

Predicted SEED Role

"DNA primase large subunit (EC 2.7.7.-)" in subsystem DNA replication, archaeal (EC 2.7.7.-)

KEGG Metabolic Maps

• Biosynthesis of siderophore group nonribosomal peptides
• Lipopolysaccharide biosynthesis
• Nucleotide sugars metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.-

Use Curated BLAST to search for 2.7.7.-

Protein Sequence (377 amino acids)

>MMJJ_RS05415 hypothetical protein (Methanococcus maripaludis JJ)
MFLDNMDSIKDLNLIDEINDSSNLILIKNRLELLFWNKNPEVSEKNGEEAVDERDEKKYL
DYLRDYQERLRVYGVGDTELFPDKIDYLTLILAANSKNHNIYIKKLAEEYAEKVPLEEGD
SRVNIWEFIDVAANSRNNDLHLERMILEGNVVLLNKKRQSIYNFEKIRLKIKNYVDMVRN
AQMHKEIKDLLVKKSEEAFDGIKIDYNIESGIKVITKEYSGEIPEDWHPPCMREILNDIL
SGGSPSHYARRSFVVYRFVSQFDPNLRPIEEGTITNRSAQDIATEEQIERFLDEIINIFK
SVGDFDVEKTKYYISHNIGYKVANHITHCEYCKNWRDDGGKGLGYYCRPDSTCSRKDIIH
PLDYLCHNINRHVKKSE