Protein Info for MMJJ_RS05400 in Methanococcus maripaludis JJ

Annotation: CoA-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02629: CoA_binding
  • amino acids 27 to 114 (88 residues), 36.9 bits, E=5.2e-13
• PF13380: CoA_binding_2
  • amino acids 29 to 145 (117 residues), 103.7 bits, E=8.4e-34

Best Hits

KEGG orthology group: K06929, (no description) (inferred from 91% identity to mmp:MMP0012)

Predicted SEED Role

"O-acetylhomoserine sulfhydrylase (EC 2.5.1.49) / O-succinylhomoserine sulfhydrylase (EC 2.5.1.48)" in subsystem Methionine Biosynthesis (EC 2.5.1.48, EC 2.5.1.49)

MetaCyc Pathways

• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (14/15 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (14/18 steps found)
• L-methionine biosynthesis II (5/6 steps found)
• aspartate superpathway (18/25 steps found)
• L-homocysteine biosynthesis (1/2 steps found)
• superpathway of S-adenosyl-L-methionine biosynthesis (6/9 steps found)
• superpathway of L-methionine biosynthesis (transsulfuration) (6/9 steps found)
• superpathway of L-homoserine and L-methionine biosynthesis (5/8 steps found)
• L-methionine biosynthesis III (2/4 steps found)
• S-methyl-5-thio-α-D-ribose 1-phosphate degradation II (2/5 steps found)
• S-methyl-5-thio-α-D-ribose 1-phosphate degradation III (2/5 steps found)
• L-methionine biosynthesis I (2/5 steps found)
• superpathway of L-methionine biosynthesis (by sulfhydrylation) (7/12 steps found)
• homocysteine and cysteine interconversion (1/4 steps found)
• superpathway of L-cysteine biosynthesis (fungi) (2/6 steps found)
• superpathway of sulfur amino acid biosynthesis (Saccharomyces cerevisiae) (3/10 steps found)

KEGG Metabolic Maps

• Biosynthesis of plant hormones
• Cysteine metabolism
• Methionine metabolism
• Selenoamino acid metabolism
• Sulfur metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.48 or 2.5.1.49

Protein Sequence (149 amino acids)

>MMJJ_RS05400 CoA-binding protein (Methanococcus maripaludis JJ)
MNRSNHTKNSELGKILEGLEIKKLLDSSKNIAVIGISKNSEKPSYFVSKYLIESGFNVYF
VNPNYSGEKILNHVVYSNISEIKERIDIVSIFVNPSRTIAIAKDAVKVGFKTFWFQLETS
NKETVNYVLKNGFDVVLEKCIMTKNQKFL