Protein Info for MMJJ_RS05295 in Methanococcus maripaludis JJ

Annotation: cobyrinic acid a,c-diamide synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 482 PF07685: GATase_3" amino acids 30 to 190 (161 residues), 33 bits, see alignment E=2.4e-12

Best Hits

Swiss-Prot: 59% identical to Y138_METJA: Putative glutamine amidotransferase-like protein MJ0138 (MJ0138) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: None (inferred from 94% identity to mmp:MMP0028)

Predicted SEED Role

"Cobyrinic acid A,C-diamide synthase" in subsystem Cobalamin synthesis or Coenzyme B12 biosynthesis

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (482 amino acids)

>MMJJ_RS05295 cobyrinic acid a,c-diamide synthase (Methanococcus maripaludis JJ)
MEIGLIDIKGTLPCFENFGNLPTKIIDENNISEIKNLEMLIIPGGSIVESGSFTEEFKKQ
ILDFDNYIVGICSGFQILSEKIDIGRKSPVPIVKEGLGLLNVEFSPLICTDLVKFNFEND
NLFGKKNQLGHGFHCHTYGNIEITNNSTEKWTTSKIEKLNYKMVGKQNILSGVFKNKVYG
TMVHNLLDNNFVVKNFLKNMKITEDEKQNIFKKNSILKEKLKNRSKISENFKTESEDKKG
IILLATGSESGKTFLSTSICSKLKGKTFVSKIGPDVRDIVPSLYLLREPMTKFSSIKISD
RGWSEPSEFLEFVKNSEFNNYIIEGVMGAFTGALNKKNYSGSEVSKILGFPVYIISSCSK
TGIEGSFVECMAYYSLLKEMGVNVAGIILNRVYNAELLDKVKKIADDLNIDLIGVNKLNV
NVDNKRGLIPEVEIDYEEFCNATMKLDFDIDIPEIKPEKINEDSKTFEKYLKIWSEKLIN
IN