Protein Info for MMJJ_RS05290 in Methanococcus maripaludis JJ

Annotation: DUF4013 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 212 transmembrane" amino acids 20 to 43 (24 residues), see Phobius details amino acids 67 to 90 (24 residues), see Phobius details amino acids 108 to 138 (31 residues), see Phobius details amino acids 159 to 180 (22 residues), see Phobius details amino acids 186 to 209 (24 residues), see Phobius details PF13197: DUF4013" amino acids 23 to 184 (162 residues), 139.2 bits, see alignment E=5.9e-45

Best Hits

KEGG orthology group: None (inferred from 98% identity to mmp:MMP0029)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (212 amino acids)

>MMJJ_RS05290 DUF4013 domain-containing protein (Methanococcus maripaludis JJ)
MDFERAFKFPTDDPDWIKKVVIGAILSIIPIVNFISFGYALELLKNIIDSKEELPEWSEF
GGKFVKGLVAVIIYIIYMIIPAIIMFVFGGTSIMAMANGHDAAIAGGIVGFGITMLLVIL
LAFVIGFIIPMAIANYIAYDEFGAAFRFSQIFDKIKDNFSDYIIMYLIIIVVGAVSGFLA
GLIPFIGMLIAVFINFYISLVYAFILGKIYIK