Protein Info for MMJJ_RS05240 in Methanococcus maripaludis JJ

Annotation: type II secretion system F family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 352 transmembrane" amino acids 120 to 140 (21 residues), see Phobius details amino acids 147 to 166 (20 residues), see Phobius details amino acids 293 to 314 (22 residues), see Phobius details amino acids 324 to 347 (24 residues), see Phobius details PF00482: T2SSF" amino acids 188 to 311 (124 residues), 46.9 bits, see alignment E=1.4e-16

Best Hits

KEGG orthology group: None (inferred from 100% identity to mmp:MMP0039)

Predicted SEED Role

"Uncharacterized protein MJ0780"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (352 amino acids)

>MMJJ_RS05240 type II secretion system F family protein (Methanococcus maripaludis JJ)
MKRKTEKKQGTFDKLANTLKGVKTPKKRKISRVGRSEYLKKIFERKTEDIHKDEILEFYE
PYIDETPEVSIDLDDLLFEKKEFGALGGYSRSFSYWVTNTSFLPSKRDYQYAGIVDERVY
FLKMMIAAITTVVLFIIYGVLTGDVFSGVSNGVLLAVIIVVGSIFYPKLKLTLFRGEIKI
QVLMSILHLISMLNSGASVQESLKNIANNPEYGITSFEFRSIIKDINQGGYNFVEALERA
KMRTKIHIMRQLYDQLILAANKGGTQLLLENLYNEIVRESMSKIDSSKFQISNLGNLIFG
IGLIIPFSGMIQSALGAQQGFDGIINAIDLVMGKIGLMSTIIFTIFIKMKIE