Protein Info for MMJJ_RS05210 in Methanococcus maripaludis JJ

Annotation: polyprenyl synthetase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00348: polyprenyl_synt
  • amino acids 24 to 271 (248 residues), 264.8 bits, E=3.3e-83

Best Hits

Swiss-Prot: 72% identical to IDSA_METJA: Short chain isoprenyl diphosphate synthase (idsA) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K13787, geranylgeranyl diphosphate synthase, type I [EC: 2.5.1.1 2.5.1.10 2.5.1.29] (inferred from 99% identity to mmp:MMP0045)

Predicted SEED Role

"Dimethylallyltransferase (EC 2.5.1.1) @ (2E,6E)-farnesyl diphosphate synthase (EC 2.5.1.10) @ Geranylgeranyl diphosphate synthase (EC 2.5.1.29)" (EC 2.5.1.1, EC 2.5.1.10, EC 2.5.1.29)

MetaCyc Pathways

• superpathway of geranylgeranyldiphosphate biosynthesis I (via mevalonate) (8/10 steps found)
• trans, trans-farnesyl diphosphate biosynthesis (2/2 steps found)
• polyisoprenoid biosynthesis (E. coli) (4/5 steps found)
• geranyl diphosphate biosynthesis (1/1 steps found)
• geranylgeranyl diphosphate biosynthesis (1/1 steps found)
• all-trans-farnesol biosynthesis (3/4 steps found)
• (3R)-linalool biosynthesis (1/2 steps found)
• (3S)-linalool biosynthesis (1/2 steps found)
• linalool biosynthesis I (1/2 steps found)
• methyl phomopsenoate biosynthesis (2/4 steps found)
• ophiobolin F biosynthesis (1/3 steps found)
• plaunotol biosynthesis (1/3 steps found)
• superpathway of linalool biosynthesis (1/3 steps found)
• bisabolene biosynthesis (engineered) (3/6 steps found)
• mono-trans, poly-cis decaprenyl phosphate biosynthesis (2/5 steps found)
• ipsdienol biosynthesis (1/4 steps found)
• stellatic acid biosynthesis (3/8 steps found)
• paspaline biosynthesis (1/6 steps found)
• brassicicene C biosynthesis (1/7 steps found)
• superpathway of geranylgeranyl diphosphate biosynthesis II (via MEP) (4/12 steps found)
• fusicoccin A biosynthesis (1/8 steps found)
• taxadiene biosynthesis (engineered) (4/13 steps found)
• viridicatumtoxin biosynthesis (1/9 steps found)
• superpathway of ubiquinol-8 biosynthesis (early decarboxylation) (3/12 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (34/56 steps found)
• superpathway of phylloquinol biosynthesis (1/15 steps found)
• superpathway of ergosterol biosynthesis I (7/26 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (10/33 steps found)
• superpathway of ergosterol biosynthesis II (3/26 steps found)
• superpathway of chorismate metabolism (25/59 steps found)
• superpathway of cholesterol biosynthesis (7/38 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Terpenoid biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.1 or 2.5.1.10 or 2.5.1.29

Protein Sequence (317 amino acids)

>MMJJ_RS05210 polyprenyl synthetase family protein (Methanococcus maripaludis JJ)
MVFDREILSKIDSELKKYMEKDTKLYGASKHLLLAGGKRVRPYLSILTYLLKKDDLTEIM
APALSVELIHNYTLVHDDIMDNDDQRRGIPTVHTVYGEPIAILAGDLLYAKAFEALSNIE
DSKKAHEVLKVLSKACVEVCEGQTEDMEFEERFPTLDEYLEMISKKTGALIVAPVEIGAV
MADCTPEEREALCNYAKRIGMTFQIQDDVLDLIGDQKTIGKPVGSDIVEGKKTMMVIHAM
ENLSEDKKERLLQILGNQDANQQEVAEAIELLADSINYAKDTMKNATEEAKDYLKIFDAE
KRKNLENIADFIIERIH