Protein Info for MMJJ_RS05180 in Methanococcus maripaludis JJ
Annotation: phosphoribosyl-ATP diphosphatase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 99% identical to HIS2_METMP: Phosphoribosyl-ATP pyrophosphatase (hisE) from Methanococcus maripaludis (strain S2 / LL)
KEGG orthology group: K01523, phosphoribosyl-ATP pyrophosphohydrolase [EC: 3.6.1.31] (inferred from 93% identity to mmq:MmarC5_1629)Predicted SEED Role
"Phosphoribosyl-ATP pyrophosphatase (EC 3.6.1.31)" in subsystem Histidine Biosynthesis (EC 3.6.1.31)
MetaCyc Pathways
- superpathway of histidine, purine, and pyrimidine biosynthesis (35/46 steps found)
- L-histidine biosynthesis (9/10 steps found)
KEGG Metabolic Maps
- Biosynthesis of alkaloids derived from histidine and purine
- Biosynthesis of plant hormones
- Histidine metabolism
Isozymes
No predicted isozymesUse Curated BLAST to search for 3.6.1.31
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (archaea)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (96 amino acids)
>MMJJ_RS05180 phosphoribosyl-ATP diphosphatase (Methanococcus maripaludis JJ) MNVLKEVYATIEKRIEEKPEGSYVAKLTTDGKKTAVNKICEKVGEEAAEVIIAAKDNDKA EIIYESADLIFHTMVLLAKSGITYEELSEEFKKRMK