Protein Info for MMJJ_RS05150 in Methanococcus maripaludis JJ

Annotation: 5-amino-6-(D-ribitylamino)uracil--L-tyrosine 4-hydroxyphenyl transferase CofH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 358 TIGR03551: 7,8-didemethyl-8-hydroxy-5-deazariboflavin synthase, CofH subunit" amino acids 11 to 357 (347 residues), 502.2 bits, see alignment E=6e-155 TIGR00423: radical SAM domain protein, CofH subfamily" amino acids 45 to 357 (313 residues), 371.8 bits, see alignment E=2.8e-115 PF04055: Radical_SAM" amino acids 53 to 227 (175 residues), 70 bits, see alignment E=2.8e-23 PF19288: CofH_C" amino acids 239 to 356 (118 residues), 62.6 bits, see alignment E=3.4e-21

Best Hits

Swiss-Prot: 99% identical to COFH2_METMP: 5-amino-6-(D-ribitylamino)uracil--L-tyrosine 4-hydroxyphenyl transferase 2 (cofH2) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: None (inferred from 99% identity to mmp:MMP0057)

MetaCyc: 55% identical to 5-amino-6-(D-ribitylamino)uracil--L-tyrosine 4-methylphenol transferase (Methanocaldococcus jannaschii)
RXN-19229 [EC: 2.5.1.147]

Predicted SEED Role

"7,8-didemethyl-8-hydroxy-5-deazariboflavin synthase subunit 2" in subsystem Coenzyme F420 synthesis

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.147

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (358 amino acids)

>MMJJ_RS05150 5-amino-6-(D-ribitylamino)uracil--L-tyrosine 4-hydroxyphenyl transferase CofH (Methanococcus maripaludis JJ)
MDLMSFKEREISKKDCVELFEDTENFFDILKLADSIRKDIVGDTVTFVKNTNIETTNVCT
MGCKFCAFSVSKNSPEAFKLDADEIAKKAVIAKKSGLTEVTIHGGIHPDVDTHFQVETIN
KVNSATSKLGGIYTHAYSPQEILNGAENAGLSINEALKMLNEAGLRTIPGTAAEILDDEV
RSDICPLKMSTKKWIDIMKTAHKTGIKTTSTIIYGHVEEYKHIVDHLSILKEIQKETGGI
TEFIPMSFLHENTPLYKSGRVTDGASGLYELKLYAIARILFKETIKNIQAPRVKIGTKLS
QLILKSGANDLGGTLVEDKVSKAAGSIYEDASVDLMRNAITSIGRIPKERTTLYEIIE