Protein Info for MMJJ_RS05095 in Methanococcus maripaludis JJ

Annotation: ammonium transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 411 transmembrane" amino acids 26 to 46 (21 residues), see Phobius details amino acids 67 to 85 (19 residues), see Phobius details amino acids 112 to 133 (22 residues), see Phobius details amino acids 140 to 160 (21 residues), see Phobius details amino acids 172 to 193 (22 residues), see Phobius details amino acids 212 to 230 (19 residues), see Phobius details amino acids 241 to 263 (23 residues), see Phobius details amino acids 271 to 309 (39 residues), see Phobius details amino acids 324 to 352 (29 residues), see Phobius details amino acids 358 to 381 (24 residues), see Phobius details PF00909: Ammonium_transp" amino acids 28 to 407 (380 residues), 331.6 bits, see alignment E=3.1e-103

Best Hits

Swiss-Prot: 64% identical to Y1343_METJA: Putative ammonium transporter MJ1343 (MJ1343) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: None (inferred from 99% identity to mmp:MMP0068)

Predicted SEED Role

"Ammonia transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (411 amino acids)

>MMJJ_RS05095 ammonium transporter (Methanococcus maripaludis JJ)
MVTADLFNNPTNIMDALNTLANSSDVMFLIFTGAFIFIMHLGFAMLEGGQVREKNVNNAM
MKNMGDWIIGCISWLLVGSVIARTLNPADFFIWWGKIASATPFLSNNGLELANWFLGLVF
AATAATIVAGGIAERIKFKSYILISIVITALLYPFFSYLGPWGAGVIPFHDYAGSLMVHG
VGGFLALGLIAAIGPRVGRFVNKKAITIPGHNIPMSILGAYILAFGWYGFNVGSSLALSD
ISGLVCATTTLAMAGGGLGGCLFSKNDVLYTANGLLAGTVAICAGTDIVSPLGALIIGFI
AGSQVPLIFKIVEKLGLDDVCGVIPVHATSGALGAILAGIFGMTAFGGVGGVSLTEQIIA
TLICAVYGTGAGFILGKLVGAVTGGLRVKESEEKAGLDISIHKLPAYPKEN