Protein Info for MMJJ_RS05070 in Methanococcus maripaludis JJ

Annotation: DNA primase catalytic subunit PriS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00335: putative DNA primase, eukaryotic-type, small subunit
  • amino acids 13 to 313 (301 residues), 234.7 bits, E=9.4e-74
• PF01896: DNA_primase_S
  • amino acids 104 to 288 (185 residues), 40 bits, E=2.6e-14

Best Hits

Swiss-Prot: 98% identical to PRIS_METMP: DNA primase small subunit PriS (priS) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K02683, DNA primase [EC: 2.7.7.-] (inferred from 98% identity to mmp:MMP0071)

Predicted SEED Role

"DNA primase small subunit (EC 2.7.7.-)" in subsystem DNA replication, archaeal (EC 2.7.7.-)

KEGG Metabolic Maps

• Biosynthesis of siderophore group nonribosomal peptides
• Lipopolysaccharide biosynthesis
• Nucleotide sugars metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.-

Use Curated BLAST to search for 2.7.7.-

Protein Sequence (357 amino acids)

>MMJJ_RS05070 DNA primase catalytic subunit PriS (Methanococcus maripaludis JJ)
MNDNPATNKVFKEVSSLYKQYFEYAILVRKWLEIPDDLSHREIGYGMLKKVDNRNMSFNT
ERDYLAWVLKESPFHLYKSLSYMEYPDIVGGAAKKGLFKREVAFDIDTHKTEKCTHDDSW
ICEECLGEARNQVLILIEDFLFPDFGLDKKDLKIVFTGNRGYHIYLKPEDPELLKRIEKW
GKNERRYFIEYILGKNLNLRNMGSRWKNILIREFNKNKIATKKFEKTSDWKTEIDNRKDN
TRRKIYETIDKVKSRLELDEKVMDDDIRLLRTIGSLHGYTGLMVKEITYNSLKNNQFDPL
NHGVFAKFHKKMYNVKIKQELDPLTLKGDTFDHNSTEIPASYLLFLFGHGIDFEILE