Protein Info for MMJJ_RS05040 in Methanococcus maripaludis JJ

Annotation: 7-carboxy-7-deazaguanine synthase QueE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 242 PF13353: Fer4_12" amino acids 17 to 121 (105 residues), 24 bits, see alignment E=4.4e-09 PF04055: Radical_SAM" amino acids 27 to 182 (156 residues), 50 bits, see alignment E=3.9e-17

Best Hits

Swiss-Prot: 61% identical to QUEE_METJA: 7-carboxy-7-deazaguanine synthase (queE) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: None (inferred from 100% identity to mmp:MMP0077)

Predicted SEED Role

"Queuosine Biosynthesis QueE Radical SAM" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (242 amino acids)

>MMJJ_RS05040 7-carboxy-7-deazaguanine synthase QueE (Methanococcus maripaludis JJ)
MIREVFSSIMGEGKFIGKRFIFVRFKECPLDCIYCDEPNAPGGTARVEEISGSGEFMEYL
EIEHELIEIIEKLRTPDLFAVSFTGGEPLVYSNKIKEYSEILKHKGYKTFLESNGMFPER
LGSYDYASIDIKLPEHFENKDDDFWYGLYKKELETIERLYLAGTDVYAKIVVFEETSEEL
IERIAIDLSKIGNITLCIQPVSPTDKIKTTTSKKKIFELMAICGKYVDVMCTPQIHKWMG
ML