Protein Info for MMJJ_RS05015 in Methanococcus maripaludis JJ

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 256 PF01493: GXGXG" amino acids 13 to 190 (178 residues), 107 bits, see alignment E=4.5e-35

Best Hits

Swiss-Prot: 70% identical to Y1350_METJA: Uncharacterized protein MJ1350 (MJ1350) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: None (inferred from 99% identity to mmq:MmarC5_1596)

Predicted SEED Role

"Glutamate synthase [NADPH] putative GlxC chain (EC 1.4.1.13)" in subsystem Ammonia assimilation or Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis (EC 1.4.1.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.4.1.13

Use Curated BLAST to search for 1.4.1.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (256 amino acids)

>MMJJ_RS05015 hypothetical protein (Methanococcus maripaludis JJ)
MKELKIDAKDMDYRELNEKIHEVLDENKDLEKLVLENVLGQRFIGNGVSRKDLTIIVNGV
PGGDLGMFMKGPKVVVNGNADHAPGNTMDEGFVVIHGSSGDVTGHSMRGGKVYVQGNVGY
RSGIHMKEYKYKFPVLVIGGAAKDFLGEYMAGGIILNFNMDKEDTENIEGRMIATGIHGG
VIYIRGIVESSQLGIAADIKDFTEEDIEKITPYIEEFCAEFGYSNEIKEKLINSKYTKIA
PISSRPFQKLYTPDLR