Protein Info for MMJJ_RS04975 in Methanococcus maripaludis JJ

Annotation: glycosyltransferase family 4 protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 355 PF13439: Glyco_transf_4" amino acids 13 to 173 (161 residues), 87.6 bits, see alignment E=2.1e-28 PF13477: Glyco_trans_4_2" amino acids 17 to 148 (132 residues), 52.7 bits, see alignment E=1.1e-17 PF00534: Glycos_transf_1" amino acids 177 to 329 (153 residues), 123 bits, see alignment E=2e-39 PF13692: Glyco_trans_1_4" amino acids 186 to 318 (133 residues), 99.2 bits, see alignment E=5.2e-32

Best Hits

Swiss-Prot: 51% identical to Y1178_METJA: Uncharacterized glycosyltransferase MJ1178 (MJ1178) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: None (inferred from 90% identity to mmp:MMP0090)

Predicted SEED Role

"Glycosyltransferase (EC 2.4.1.-)" (EC 2.4.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.-

Use Curated BLAST to search for 2.4.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (355 amino acids)

>MMJJ_RS04975 glycosyltransferase family 4 protein (Methanococcus maripaludis JJ)
MKILLPSIYYPFIGGVSIHVENLIKNLNKLDDFEFHILNYNFDETINNSFENVTIHKVPY
FSKLRGPSYILNGYKIGKKIIKDEKIDLIHSHYAAPQGFLGATLGKKCSIPTVLTLHGSD
VLNLSKNTFGKYFFNYAVYNSEKIICVSEFLKNNLKTNFNLDSDVIYNGFDEELFNPSDN
DKNYGLFVGSLVEQKGIFYFLESIKNIDFNFKIIGNGPLYTKIMDFIKVNDIKNVELLGT
KTQSQVSEYLKNCSFLVLPSISEGLGMTIIEAFACKKAVIGSNVGGIPELIKDEINGYIV
PPKNTKILEDKINMLVNDKNLRKSLGNEGLNYSKNFSWRLSSKKTYDIYDSLLNR