Protein Info for MMJJ_RS04950 in Methanococcus maripaludis JJ

Annotation: TIGR00375 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 393 TIGR00375: TIGR00375 family protein" amino acids 4 to 372 (369 residues), 447.5 bits, see alignment E=2.4e-138

Best Hits

KEGG orthology group: None (inferred from 96% identity to mmp:MMP0095)

Predicted SEED Role

"DNA helicase II (EC 3.6.1.-)" (EC 3.6.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-

Use Curated BLAST to search for 3.6.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (393 amino acids)

>MMJJ_RS04950 TIGR00375 family protein (Methanococcus maripaludis JJ)
MIINADLHIHSKYSMGTSKYMDIEHILKYGPVKGLDLIATGDCLHSKWLEEIEKNVNKPL
LLSTEVEDRNRVHHLIYLPHTSQAHDLRDKFSKYSKNIDADGRPRVSLNGMEIIDAVRDI
GGLIGPAHAFTPWTSIYKSFTSIYNCYARKPDFIELGLSADTDMADMVEELRDLPFLSNS
DAHSFYSHRLGREFNQMDVDELGGLETNFEEVRKVLKHNKITANYGLDPNLGKYHLTACT
RCYTRFTLEDATENNFKCPECKGTIKKGVHDKTLELSKDKKVVHPDFRPEYHKIIPLAEI
ISLAIGKNIGTKSVDTIWEQYIEKYGNEIDVLINEDISELKKINEKVGHIIDLFRTGKIY
IYPGGGGEYGHISKVPVSVKWFKPKLTLDSWVK