Protein Info for MMJJ_RS04910 in Methanococcus maripaludis JJ

Annotation: pyridoxal 5'-phosphate synthase lyase subunit PdxS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01680: SOR_SNZ
  • amino acids 8 to 217 (210 residues), 335 bits, E=2.9e-104
• TIGR00343: pyridoxal 5'-phosphate synthase, synthase subunit Pdx1
  • amino acids 9 to 298 (290 residues), 472.5 bits, E=2.7e-146
• PF05690: ThiG
  • amino acids 201 to 264 (64 residues), 30 bits, E=5.1e-11

Best Hits

Swiss-Prot: 99% identical to PDXS_METM7: Pyridoxal 5'-phosphate synthase subunit PdxS (pdxS) from Methanococcus maripaludis (strain C7 / ATCC BAA-1331)

KEGG orthology group: K06215, pyridoxine biosynthesis protein [EC: 4.-.-.-] (inferred from 98% identity to mmp:MMP0103)

MetaCyc: 62% identical to pyridoxal 5'-phosphate synthase complex PdxS synthase subunit (Bacillus subtilis)
RXN-11322 [EC: 4.3.3.6]

Predicted SEED Role

"Pyridoxine biosynthesis glutamine amidotransferase, synthase subunit (EC 2.4.2.-)" in subsystem Pyridoxin (Vitamin B6) Biosynthesis (EC 2.4.2.-)

MetaCyc Pathways

• L-asparagine biosynthesis III (tRNA-dependent) (4/4 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (4/4 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• L-glutamine degradation I (1/1 steps found)
• pyridoxal 5'-phosphate biosynthesis II (1/1 steps found)
• L-citrulline biosynthesis (4/8 steps found)
• L-glutamate and L-glutamine biosynthesis (3/7 steps found)
• superpathway of L-citrulline metabolism (6/12 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of plant hormones
• Biosynthesis of type II polyketide backbone
• Photosynthesis - antenna proteins
• Porphyrin and chlorophyll metabolism
• Purine metabolism
• Vitamin B6 metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.4.2.-

Use Curated BLAST to search for 2.4.2.- or 4.-.-.- or 4.3.3.6

Protein Sequence (299 amino acids)

>MMJJ_RS04910 pyridoxal 5'-phosphate synthase lyase subunit PdxS (Methanococcus maripaludis JJ)
MKKLGTDLLKRGFAKMVKHGVVMDVTNVEQALIAEEAGAAAVMALERVPADIRVQGGVAR
MSDPEMILEIKDAVSIPVMAKARIGHYVEAQVLESIGVDMVDESEVLTPADEVNHIDKRA
FTAPFVCGARNLGEALRRIDEGAAMIRTKGEAGTGNVVEAVKHMRAVNEGIARVVGYKEM
GLEAELIQMARNELKVPMELISEVAELKRLPVVNFAAGGIATPADAALMMQMGCDGVFVG
SGIFKSGNPATRAKAIVEATYNFDKADVIGEVSKNLGEAMVGINIDEIPEEKLLAKRGI