Protein Info for MMJJ_RS04840 in Methanococcus maripaludis JJ

Annotation: iron ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 545 transmembrane" amino acids 21 to 44 (24 residues), see Phobius details amino acids 73 to 96 (24 residues), see Phobius details amino acids 108 to 129 (22 residues), see Phobius details amino acids 153 to 176 (24 residues), see Phobius details amino acids 197 to 216 (20 residues), see Phobius details amino acids 250 to 270 (21 residues), see Phobius details amino acids 293 to 318 (26 residues), see Phobius details amino acids 349 to 371 (23 residues), see Phobius details amino acids 383 to 401 (19 residues), see Phobius details amino acids 407 to 424 (18 residues), see Phobius details amino acids 467 to 494 (28 residues), see Phobius details amino acids 514 to 536 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 372 to 533 (162 residues), 40.3 bits, see alignment E=1.4e-14

Best Hits

KEGG orthology group: K02011, iron(III) transport system permease protein (inferred from 95% identity to mmp:MMP0109)

Predicted SEED Role

"Ferric iron ABC transporter, permease protein" in subsystem Campylobacter Iron Metabolism or Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (545 amino acids)

>MMJJ_RS04840 iron ABC transporter permease (Methanococcus maripaludis JJ)
MKEVFNKETLTKIYPKILENGFYILANVFLLIFIMYPVFTVFLQSFYGSNGFTLDAYSKF
ISDSYYFGILKNSIVVACFSTIISIFLGFIFSIIIFKTDFKFKNFFKIAVFLPIITPGFI
SSLAYVFLFGRHGAVTYGLLGLEPNIYGWKSVVIMQSIDYTTTAFFIISAVLLGISGEFE
DAARNLGSNEFQVFKKVTLPLLIPGILSAGLLIFMQSMADFGTPIIVGGNFNTLATASYF
EIIGRYNTQMASTLSVILLFPSMALFYLYSKYHKGYELKKSKLTKYSLSNIQKIILGFPA
IFFSILAYLLFFAVFVASFTKSFGHNYALTLDYFFEAISAGQLAIKNTLFYALSSSILVA
FLGVAYSYIIYRGKFFGRKLMDLVITLPFAIPGTFMGLGYLLAFNNYPLLLTGTSSIIIL
NCMVRKLPFSFKTGNSVLSQIEESVEEASLNLGASRLKTFYKVVLPLLEPAIIFSMIYTF
IATIKSLGSIIFLMTANTKVLSAMVFESTINRQLGVGACYSMFMVILSIIGILGILRLKG
DKKWI