Protein Info for MMJJ_RS04810 in Methanococcus maripaludis JJ

Annotation: nitroreductase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 173 PF00881: Nitroreductase" amino acids 5 to 61 (57 residues), 52.2 bits, see alignment E=8.8e-18 amino acids 63 to 146 (84 residues), 33.1 bits, see alignment E=6.4e-12

Best Hits

Swiss-Prot: 47% identical to Y120_METTH: Putative NADH dehydrogenase/NAD(P)H nitroreductase (MTH_120) from Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)

KEGG orthology group: K00540, [EC: 1.-.-.-] (inferred from 99% identity to mmp:MMP0115)

Predicted SEED Role

"NADPH nitroreductase"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (173 amino acids)

>MMJJ_RS04810 nitroreductase family protein (Methanococcus maripaludis JJ)
MNAIFERRSIRHYTSEDVSEEIVDDLLKAAMAAPSACDQRPWDFVVIRDKNTLSGISKIN
RHARMLNEAPVSIVVCGNMDRVNGSCGQFWVQDCAAATENILIEAQDRGIGAVWLGFYPV
DERVEKMRKVLHAPENVVPFSVVALGNPAEKPVPVEKFDRERIHYEKWPTGYL