Protein Info for MMJJ_RS04765 in Methanococcus maripaludis JJ

Annotation: metal-dependent hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 224 transmembrane" amino acids 7 to 32 (26 residues), see Phobius details amino acids 45 to 65 (21 residues), see Phobius details amino acids 72 to 91 (20 residues), see Phobius details amino acids 103 to 131 (29 residues), see Phobius details amino acids 138 to 156 (19 residues), see Phobius details amino acids 168 to 186 (19 residues), see Phobius details amino acids 206 to 222 (17 residues), see Phobius details PF04307: YdjM" amino acids 1 to 202 (202 residues), 64.2 bits, see alignment E=5.6e-22

Best Hits

Swiss-Prot: 56% identical to Y790_METJA: Uncharacterized protein MJ0790 (MJ0790) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K07038, inner membrane protein (inferred from 100% identity to mmp:MMP0124)

Predicted SEED Role

"Uncharacterized protein MJ0790"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (224 amino acids)

>MMJJ_RS04765 metal-dependent hydrolase (Methanococcus maripaludis JJ)
MNWKGHITLGILMGLPFISSPEQIFLLVAGALYPDLDHDVKSEIVQRGLYISGGLILVSI
LAYLFRPEYFNTGFFIAAILSGVIYITPYYAEHRGITHTFLSLGVMSIILGYLTFKLSII
SPIMASLIALIMVTNNKLLGKSVAISVFAWVLYNMISTSFTTFQGLEFYIIPIAIGYLSH
LVGDCMTPMGCRTLYPLNYTFHKKEGYFAIAIWVLLVFYVIKLA