Protein Info for MMJJ_RS04755 in Methanococcus maripaludis JJ

Annotation: 5,10-methenyltetrahydromethanopterin hydrogenase cofactor biosynthesis protein HmdB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03957: 5,10-methenyltetrahydromethanopterin hydrogenase cofactor biosynthesis protein HmdB
  • amino acids 26 to 340 (315 residues), 520.9 bits, E=5.7e-161
• PF04055: Radical_SAM
  • amino acids 68 to 230 (163 residues), 68.4 bits, E=8.7e-23
• PF06968: BATS
  • amino acids 239 to 336 (98 residues), 28.3 bits, E=1.7e-10

Best Hits

Swiss-Prot: 75% identical to Y785_METJA: Uncharacterized protein MJ0785 (MJ0785) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K01012, biotin synthetase [EC: 2.8.1.6] (inferred from 97% identity to mmp:MMP0126)

Predicted SEED Role

"Biotin synthase-related protein in some methanogens"

MetaCyc Pathways

• biotin biosynthesis from 8-amino-7-oxononanoate I (4/4 steps found)
• biotin biosynthesis II (5/6 steps found)
• biotin biosynthesis from 8-amino-7-oxononanoate II (3/4 steps found)
• biotin biosynthesis from 8-amino-7-oxononanoate III (3/5 steps found)
• biotin biosynthesis I (5/15 steps found)

KEGG Metabolic Maps

• Biotin metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.8.1.6

Use Curated BLAST to search for 2.8.1.6

Protein Sequence (341 amino acids)

>MMJJ_RS04755 5,10-methenyltetrahydromethanopterin hydrogenase cofactor biosynthesis protein HmdB (Methanococcus maripaludis JJ)
MIFSKIRGNFKDLKDGKIDVKQGIITKSDAIELFNIKNWKDYLELFSIASEVRDVFKTEI
EITSTVHITNICSVTPKCKYCGFAAGTSSEGYVKPFRSDDDQIKSSSVAIENSGIKRVSC
SSGHGYNGKEVIRALKAVKSVSNLEVLVNAGADLTEECILELKKYNIDTICCNLETTNKT
VFKSVKPGENLEDRINVCKMVKKHGVELSSGLLIGIGETYEDRVEHLFFLKELDVEEIPI
MGFNPYKETPMETCPKCSAIEQAKTIAIVRLLFPDIRITSPTPTMGPELAQFALLGGASN
IATVIPDNHPMNIKGVGNPKTGNLNDVICMIKELGLTPKLN