Protein Info for MMJJ_RS04750 in Methanococcus maripaludis JJ

Annotation: 5,10-methenyltetrahydromethanopterin hydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01723: 5,10-methenyltetrahydromethanopterin hydrogenase
  • amino acids 1 to 341 (341 residues), 570.3 bits, E=6.7e-176
• PF03201: HMD
  • amino acids 243 to 339 (97 residues), 129.5 bits, E=2.4e-42

Best Hits

Swiss-Prot: 99% identical to HMD_METMP: 5,10-methenyltetrahydromethanopterin hydrogenase (hmd) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K13942, 5,10-methenyltetrahydromethanopterin hydrogenase [EC: 1.12.98.2] (inferred from 99% identity to mmp:MMP0127)

MetaCyc: 60% identical to Hmd (Methanothermobacter thermautotrophicus)
5,10-methenyltetrahydromethanopterin hydrogenase. [EC: 1.12.98.2]

Predicted SEED Role

"H(2)-dependent N5,N10-methylenetetrahydromethanopterin dehydrogenase"

MetaCyc Pathways

• gluconeogenesis II (Methanobacterium thermoautotrophicum) (16/18 steps found)
• methanogenesis from H₂ and CO₂ (6/6 steps found)
• reductive acetyl coenzyme A pathway II (autotrophic methanogens) (5/6 steps found)
• superpathway of methanogenesis (11/21 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (34/56 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.12.98.2

Protein Sequence (354 amino acids)

>MMJJ_RS04750 5,10-methenyltetrahydromethanopterin hydrogenase (Methanococcus maripaludis JJ)
MKVAILGAGCYRTHAASGITNFSRASQVAKEAGIPEIAMTHSTITMGAELLHLIPEITEV
VVSDPCFAEEPGIVVLDQFDYKAVMEAHLAGDAEKVMPEIREAVKAKAKETPKPPKGCIH
FVHPETVGLKVTASDVEAVKDADIVITWLPKGGSQPAIIEKFAGEIKKGAIVTHACTIPT
PKFAKIFKDLGRDDLNIIAYHPGAVPEMKGQAFLSEGLADAEKVEEFYCMAKTARGEAFK
MPANLISPVCDMGSAVTAPVYAAILAYRDAVTQILGAPADFAQMMADEAISQILDLMRNE
GIKNMEDKLNPKALTGTADSMCFGPLADILPASLKVLEKHANENKCECGCSIKP