Protein Info for MMJJ_RS04720 in Methanococcus maripaludis JJ

Annotation: IMP dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00478: IMPDH
  • amino acids 16 to 483 (468 residues), 496.6 bits, E=9.2e-153
• TIGR01302: inosine-5'-monophosphate dehydrogenase
  • amino acids 16 to 465 (450 residues), 576 bits, E=2.9e-177
• PF00571: CBS
  • amino acids 98 to 146 (49 residues), 50 bits, 7.9e-17
  • amino acids 156 to 210 (55 residues), 51.2 bits, 3.1e-17
• PF01645: Glu_synthase
  • amino acids 259 to 368 (110 residues), 24.5 bits, E=3.7e-09
• PF01070: FMN_dh
  • amino acids 263 to 368 (106 residues), 42.2 bits, E=1.4e-14
• PF03060: NMO
  • amino acids 276 to 379 (104 residues), 32.5 bits, E=1.6e-11

Best Hits

Swiss-Prot: 71% identical to IMDH_METJA: Inosine-5'-monophosphate dehydrogenase (guaB) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K00088, IMP dehydrogenase [EC: 1.1.1.205] (inferred from 100% identity to mmp:MMP0133)

Predicted SEED Role

"Inosine-5'-monophosphate dehydrogenase (EC 1.1.1.205) / CBS domain" in subsystem Purine conversions (EC 1.1.1.205)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (35/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (17/21 steps found)
• guanosine ribonucleotides de novo biosynthesis (3/4 steps found)
• superpathway of purine nucleotide salvage (10/14 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis I (4/6 steps found)
• inosine 5'-phosphate degradation (2/4 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (17/26 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis II (4/8 steps found)
• purine nucleotides degradation II (aerobic) (6/11 steps found)
• adenosine nucleotides degradation I (3/8 steps found)
• ureide biosynthesis (2/7 steps found)
• purine nucleotides degradation I (plants) (4/12 steps found)
• superpathway of purines degradation in plants (4/18 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Drug metabolism - other enzymes
• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.205

Use Curated BLAST to search for 1.1.1.205

Protein Sequence (500 amino acids)

>MMJJ_RS04720 IMP dehydrogenase (Methanococcus maripaludis JJ)
MVVILFLDKIVSAQRAYTFDDVLLVPNKSFVDPKTTDVSVDIAGLKLNIPIISAAMDTVS
EKDLAIALARRGGIAVIHRNMTVEEQLKHVKAVKMAENLVIRDVVTVEPSSSVLDAERIM
YEYNVSGLPVVSENKTLVGILTTRDLKFVPDKNVAVETVMTKEVLHVHEDTPYEEILNRL
YENKIERLPILDKNTKELLGMVTLRDILKRKKYPDAARDSDGKLVVAAACGPSDFERAEA
LVLAGVDAVAIDCAHAHNMQVVENVKKLKEILKGTKTKLFVGNIATGEAAEDLIKAGADA
LKVGIGPGSICTTRVVAGVGVPQLTAVAEVAEVAKKYGVPVIADGGIKYSGDIAKAIAAG
ANAVMVGSLLAGTEEAPGSLMTINGRKYKQYRGMGSLGAMCGSSGNVADRYFQSGHMKHS
KLVPEGIEGAVPYKGPTSDIVYQLIGGLRSSMGYCGAQNLSEMHEKARFVIITQSGQKES
HPHDVLITNEAPNYPINAER