Protein Info for MMJJ_RS04710 in Methanococcus maripaludis JJ

Annotation: threonine synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00260: threonine synthase
  • amino acids 52 to 379 (328 residues), 388 bits, E=2e-120
• PF00291: PALP
  • amino acids 68 to 372 (305 residues), 280.9 bits, E=6.4e-88

Best Hits

Swiss-Prot: 78% identical to THRC_METJA: Threonine synthase (thrC) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K01733, threonine synthase [EC: 4.2.3.1] (inferred from 99% identity to mmp:MMP0135)

MetaCyc: 78% identical to threonine synthase (Methanocaldococcus jannaschii)
Threonine synthase. [EC: 4.2.3.1]

Predicted SEED Role

"Threonine synthase (EC 4.2.3.1)" in subsystem Threonine and Homoserine Biosynthesis (EC 4.2.3.1)

MetaCyc Pathways

• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (14/15 steps found)
• superpathway of L-isoleucine biosynthesis I (12/13 steps found)
• superpathway of L-threonine biosynthesis (6/6 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (14/18 steps found)
• L-threonine biosynthesis (2/2 steps found)
• aspartate superpathway (18/25 steps found)

KEGG Metabolic Maps

• Glycine, serine and threonine metabolism
• Vitamin B6 metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.3.1

Protein Sequence (404 amino acids)

>MMJJ_RS04710 threonine synthase (Methanococcus maripaludis JJ)
MIQKCRVCGKEYDVDAIIYNCECGGLLEIKYDFESIKEKVSKESLRERELGVWRYLDYLP
VKDPAKIVSLHEGGTPLYKCENLAKKLGMKELYVKNEGANPTGSFKDRGMTVGVTRANEL
GVEVVGCASTGNTSASLAAYSARAGKKCIVLLPGGKVALGKLAQAMFYGAKVIQINGNFD
EALVMVKNLALENKLYLLNSVNPFRLEGQKTIGFEICDQLDFEVPDMVILPVGNAGNISA
IWKGFKEFKETEMIDRLPKMTGIQAEGAQPIVKAIKEGLDEIVPDENPETIATAIRIGNP
VNAAKALDAIKSSGGLAESVNDEEIIEAQKLLAQTEGIFVEPASASSIAGLIKLINMGLI
DKNQKIVCITTGNGLKDPDAAIKASTMPTEIECDMDVLRKAIDE